Basic Information | |
---|---|
Taxon OID | 3300001844 Open in IMG/M |
Scaffold ID | RCM35_1019262 Open in IMG/M |
Source Dataset Name | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM35, ROCA_DNA220_0.2um_bLM_C_3a |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 501 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ponta de Pedras, Para, Brazil | |||||||
Coordinates | Lat. (o) | -1.519367 | Long. (o) | -48.91795 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001774 | Metagenome / Metatranscriptome | 636 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
RCM35_10192622 | F001774 | AGGAG | MALKLALKKTQFGIPAPQAYAKITNFFGNKDNIQVQVAIYYDEQARQENRSTVMEHAHYIAIEDLKGDLIPAIYAILKTFSQYEGAVDA* |
⦗Top⦘ |