NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12053J15887_10012677

Scaffold JGI12053J15887_10012677


Overview

Basic Information
Taxon OID3300001661 Open in IMG/M
Scaffold IDJGI12053J15887_10012677 Open in IMG/M
Source Dataset NameMediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4648
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameEl Dorado National Forest, Georgetown, California, USA
CoordinatesLat. (o)38.88Long. (o)-120.64Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000149Metagenome / Metatranscriptome1910Y
F001674Metagenome / Metatranscriptome654Y
F019356Metagenome / Metatranscriptome230Y
F065644Metagenome / Metatranscriptome127Y

Sequences

Protein IDFamilyRBSSequence
JGI12053J15887_100126771F001674GGAGMAELSRDEVVGVLGRLSDVIIAEIIATGITKDELAAARERVVRDRKAHNPGSPLEPGPFAQVVDILERSPGR
JGI12053J15887_100126772F000149GGAGGVTLIVYYVVFMIVGDFAAYFLGLFTEYEWGSQVSLIVFLALYFLFLWVSWVLAVRVTKPKTVEQQSS*
JGI12053J15887_100126773F065644GGAGGMKSTFTIIAVGLLAGSLATSADAATQRKNAGMAQLQAQCQAQAKKKYSAIHFLKRRAFVKSCMNQKA*
JGI12053J15887_100126776F019356N/AMPIRPYLDGQKFDPETIRVLGIAFEMALVALRLADRGDLANEVVARKIINLAKAGERDPERLCEAMMKEFRAPPQV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.