NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12635J15846_10217553

Scaffold JGI12635J15846_10217553


Overview

Basic Information
Taxon OID3300001593 Open in IMG/M
Scaffold IDJGI12635J15846_10217553 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1250
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001352Metagenome / Metatranscriptome717Y

Sequences

Protein IDFamilyRBSSequence
JGI12635J15846_102175532F001352N/ACLTLTRRHDTI*LWPSNL*VGLRPSQMSSRELSPEWVLSSFIPPIAAPQHEITELIAIARRLWPSVQAHAYREQPGKSSDEALDFASEVWEGVLRSVAKTIQRSNGRNWRIRDMEAYLFGAFHHRFNRALKKERRRLRTIQHLPTSHDLERLGQAHDSKAVRDLEESIQLKEAVRNMDEWTRKVWAARQYGYSWKEIATQLGLTEPQVKLRFRYAIGKLRARLGGGL*SLRRARLVCIDRSR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.