NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12090J15751_1032868

Scaffold JGI12090J15751_1032868


Overview

Basic Information
Taxon OID3300001569 Open in IMG/M
Scaffold IDJGI12090J15751_1032868 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Indian Ocean - MP0960
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)637
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameEast of Madagascar, South Indian Ocean
CoordinatesLat. (o)-27.98Long. (o)63.25Alt. (m)Depth (m)3504.69
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029128Metagenome189N

Sequences

Protein IDFamilyRBSSequence
JGI12090J15751_10328681F029128AGGAGMKNKIIQIVIMIIIGVGGFYGGIYYGIMKTDVYIENLMSEFEKISDDVDAFVKVSDPETIRHYVKELNKILDDIKYLGKMVESGQLADEALTEFFNSYQNKLDNLNERVVVLALETQGMLSEISGEVKSDLRTNKVELENKLKSESDSVRKEIRKLYDKTDELYKELEQVSILLDKAKETFIGKQVFK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.