NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold F14TB_101074037

Scaffold F14TB_101074037


Overview

Basic Information
Taxon OID3300001431 Open in IMG/M
Scaffold IDF14TB_101074037 Open in IMG/M
Source Dataset NameAmended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)636
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Kansas Great Prairie, Usa, Amended With Brdu

Source Dataset Sampling Location
Location NameKanza Prairie, Kansas, USA
CoordinatesLat. (o)39.100992Long. (o)-96.608258Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F101374Metagenome102Y

Sequences

Protein IDFamilyRBSSequence
F14TB_1010740371F101374GGAGGMTWAIRYLIIIVLFTGLARGQAAKDSDERRKAILDYQLTMPRANQLISGLEEMTKYVVSLPDYGERVRKSMQMTPVEQMARIDKDPKASDILKKNQPTAKDYIVGVPALRMALLAASGMPQGPNIIASPANVAFAKANLSVLKPKMDAADGAALRR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.