NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SWIR1_1030884

Scaffold SWIR1_1030884


Overview

Basic Information
Taxon OID3300001391 Open in IMG/M
Scaffold IDSWIR1_1030884 Open in IMG/M
Source Dataset NameHydrothermal vent microbial communities from the Southwest Indian Ridge - SWIR1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)557
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Hydrothermal Vent Microbial Communities From The Southwest Indian Ridge

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059476Metagenome / Metatranscriptome134Y

Sequences

Protein IDFamilyRBSSequence
SWIR1_10308842F059476N/ALVKKMAEQNNRQQSIRMVITVVLLVLLALGFFAASFFALS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.