| Basic Information | |
|---|---|
| Taxon OID | 3300001390 Open in IMG/M |
| Scaffold ID | SMAR1_102086 Open in IMG/M |
| Source Dataset Name | SMAR1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2026 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Hydrothermal Vent Microbial Communities From The Southwest Indian Ridge |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F072876 | Metagenome | 121 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SMAR1_1020864 | F072876 | N/A | MELSKQSYLQILEMPIQRFYNYLKWKTELEEEKRKLMEEKTSNG* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |