NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12316J14372_10000462

Scaffold JGI12316J14372_10000462


Overview

Basic Information
Taxon OID3300001341 Open in IMG/M
Scaffold IDJGI12316J14372_10000462 Open in IMG/M
Source Dataset NameMarine cyanobacterial communities from Panama - species 1 Leptolyngbya sp. v3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)76861
Total Scaffold Genes57 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)48 (84.21%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Cyanobacterial Communities From Panama, Similar To Oscillatoria Species

Source Dataset Sampling Location
Location NamePanama: Panama City
CoordinatesLat. (o)9.28Long. (o)-79.97Alt. (m)Depth (m)48.85
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008191Metagenome / Metatranscriptome337Y

Sequences

Protein IDFamilyRBSSequence
JGI12316J14372_1000046213F008191N/ALTCADCRWWHFQSTETAASRDDEQAVGYCRRMPPERRENGVGAWPITFPTDWCGEYVHKDDVSYQIGEGFTAVS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.