Basic Information | |
---|---|
Taxon OID | 3300001313 Open in IMG/M |
Scaffold ID | XXXXXX_12426 Open in IMG/M |
Source Dataset Name | Bioengineered switchgrass rhizosphere microbial community from Knoxville, Tennessee, USA - 26-Joint |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 540 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Bioengineered Switchgrass Rhizosphere Microbial Community From Knoxville, Tennessee, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Knoxville, Tennessee, USA | |||||||
Coordinates | Lat. (o) | 35.98 | Long. (o) | -83.92 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032399 | Metagenome / Metatranscriptome | 180 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
XXXXXX_124261 | F032399 | N/A | ATKKTGTAVFTMVNGTGVRIISASIAGNGNSLTIGVGLLRIDGSGSSIISVTTKNGSGNRGTFIVNVAADPACGSTQQLKVNVNN* |
⦗Top⦘ |