NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Bac131567_1217264

Scaffold Bac131567_1217264


Overview

Basic Information
Taxon OID3300001298 Open in IMG/M
Scaffold IDBac131567_1217264 Open in IMG/M
Source Dataset NamePermafrost soil microbial communities from Miers Valley, Antarctica - Ant1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8997
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost Soil → Permafrost Soil Microbial Communities From Miers Valley, Antarctica

Source Dataset Sampling Location
Location NameLake Miers, Antarctica
CoordinatesLat. (o)-78.099535Long. (o)163.850256Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051905Metagenome143N

Sequences

Protein IDFamilyRBSSequence
Bac131567_12172646F051905N/AMNGNYKLRNDETIISSISVTDIVFDVYLGKCNYRAIPKVKTWSYFLTIPN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.