Basic Information | |
---|---|
Taxon OID | 3300000932 Open in IMG/M |
Scaffold ID | JGI12479J12853_1005162 Open in IMG/M |
Source Dataset Name | Aerobic enrichment media microbial communities from Eden Landing Ponds, California, USA - A23 P3 (2) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4182 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Emeryville, CA | |||||||
Coordinates | Lat. (o) | 37.840854 | Long. (o) | -122.289843 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F033243 | Metagenome | 178 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI12479J12853_10051621 | F033243 | N/A | QGPIDLVGHGAEPVLAAGYSTLELERAGLTVEKARELGIPVDAGRCSGVGANVMQLRALLTS* |
⦗Top⦘ |