Basic Information | |
---|---|
Taxon OID | 3300000546 Open in IMG/M |
Scaffold ID | LJNas_1000683 Open in IMG/M |
Source Dataset Name | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI), Lifesequencing S.L. |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5725 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere → Quercus Rhizosphere Microbial Communities From Sierra Nevada National Park, Granada, Spain |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sierra Nevada National Park, Granada, Spain | |||||||
Coordinates | Lat. (o) | 36.96971 | Long. (o) | -3.46027 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001885 | Metagenome / Metatranscriptome | 622 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LJNas_10006835 | F001885 | AGAAG | MAQEYLSIAIWEPLPGLEAASLATMRELNAIVANKAYGRDHLYRGGDSHYLLLRYWNSEQARSTAQEDPEILRCWARLGNEIRILKVYEKLEEVTE* |
⦗Top⦘ |