NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Draft_104106

Scaffold Draft_104106


Overview

Basic Information
Taxon OID3300000507 Open in IMG/M
Scaffold IDDraft_104106 Open in IMG/M
Source Dataset NameCoal-degrading lab enrichment microbial communities from Bowden, Alberta, Canada- QSAFCN5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1997
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameBowden, Alberta, Canada
CoordinatesLat. (o)51.9740275Long. (o)-113.8051889Alt. (m)Depth (m)324
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074913Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Draft_1041064F074913AGGMWRWRRVAVARVFALVVRCRVMMLFVYSRVGKNRDTRRESPAGAGAGRGASHKTASLFTQLSRHGAPMTYTDLL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.