| Basic Information | |
|---|---|
| Taxon OID | 3300000374 Open in IMG/M |
| Scaffold ID | P_1C_Sed_2_UnCtyDRAFT_1064728 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial community from Union City, CA, USA - Pond 1C Sediment 2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 623 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Salt Pond → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Eden Landing Ponds, San Francisco, CA, USA | |||||||
| Coordinates | Lat. (o) | 37.569083 | Long. (o) | -122.103267 | Alt. (m) | Depth (m) | .3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062246 | Metagenome | 131 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| P_1C_Sed_2_UnCtyDRAFT_10647282 | F062246 | N/A | MYVLHDFKYIFILIVFHMERKLREISGSYVITIPKQVCDLYGYKPNDVFKIEPIGGGELRLRKV* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |