NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ElkS_mat_CD2ADRAFT_1009709

Scaffold ElkS_mat_CD2ADRAFT_1009709


Overview

Basic Information
Taxon OID3300000347 Open in IMG/M
Scaffold IDElkS_mat_CD2ADRAFT_1009709 Open in IMG/M
Source Dataset NameHot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - CD2A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2090
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameElkhorn Slough, Monterey Bay, California, USA
CoordinatesLat. (o)36.82188Long. (o)-121.744Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034932Metagenome / Metatranscriptome173Y
F062769Metagenome / Metatranscriptome130Y

Sequences

Protein IDFamilyRBSSequence
ElkS_mat_CD2ADRAFT_10097092F034932GAGGMRTVRIESESHNLIAGFVAGIEWVNDSAVAVVDLQYCGRTAFVVLEDRDGSGEDAVLRLTSDGLADEE*
ElkS_mat_CD2ADRAFT_10097094F062769AGGAGMTDLDAFSNWLTSATRAAILAVRARVYLAREQHPAWRSATNTILKRITQELAARGEYDRRCVA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.