NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LPaug09P202000mDRAFT_1021892

Scaffold LPaug09P202000mDRAFT_1021892


Overview

Basic Information
Taxon OID3300000323 Open in IMG/M
Scaffold IDLPaug09P202000mDRAFT_1021892 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P20 2000m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1004
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → unclassified Nitrososphaerales → Nitrososphaerales archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameP20, Pacific Ocean
CoordinatesLat. (o)49.566667Long. (o)-138.666667Alt. (m)Depth (m)2000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024888Metagenome204Y

Sequences

Protein IDFamilyRBSSequence
LPaug09P202000mDRAFT_10218922F024888AGGAMNLDKIDLKNIHKIVGKIVDGIQKKEMKGKTPDEFAQERGFDNWLEYAAWSRHTGGDYHMMEMMLKSKWKEQDPEEFARQKKIEGDQRTREHSYIGILDEEKIKKKNNGHKYYKPVHKSEFSAEELEVIYDERGVGGEPVEYRW*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.