NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LPaug09P202000mDRAFT_1014603

Scaffold LPaug09P202000mDRAFT_1014603


Overview

Basic Information
Taxon OID3300000323 Open in IMG/M
Scaffold IDLPaug09P202000mDRAFT_1014603 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P20 2000m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1359
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameP20, Pacific Ocean
CoordinatesLat. (o)49.566667Long. (o)-138.666667Alt. (m)Depth (m)2000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001334Metagenome / Metatranscriptome720Y
F003285Metagenome / Metatranscriptome496Y

Sequences

Protein IDFamilyRBSSequence
LPaug09P202000mDRAFT_10146032F003285GAGGMPEQESIHQLQTEIQTLKIKDEFRTKELDALMNKLSDTSSKLNALSENIGRLLAGQELHKTSDNEVRDELKILHTRIGDLHDKCTEMIDKTETRVSSDISLLYKKVDSLEKWRWITIGIATAIAWLLTNIIPKFLSN*
LPaug09P202000mDRAFT_10146033F001334GGAMKFKEYLQINADDSIEQIMSGEWIQKSRSTWKATDDEDNKIEIHNDGHDPELNGESWTVHTNTFAPKAFAYFTKQFIKEVKPSEVTHARTRIYPSTSN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.