NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BS_KBA_SWE21_205mDRAFT_10077438

Scaffold BS_KBA_SWE21_205mDRAFT_10077438


Overview

Basic Information
Taxon OID3300000241 Open in IMG/M
Scaffold IDBS_KBA_SWE21_205mDRAFT_10077438 Open in IMG/M
Source Dataset NameMarine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)734
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location NameKBB site, Vaertahamnen, Baltic Sea, Sweden
CoordinatesLat. (o)59.350163Long. (o)18.107847Alt. (m)Depth (m)20.5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020338Metagenome / Metatranscriptome224N
F055661Metagenome / Metatranscriptome138N

Sequences

Protein IDFamilyRBSSequence
BS_KBA_SWE21_205mDRAFT_100774381F020338N/AATNTASRLYEYDATALSELDLAVYDPDETLPQYRRSLLTDRCHNDEDKPVTVMAKMRHINATSVNDYLIPPCPDAIKLMVMAIRKEENDLIQEAVAYEAKAVQAVQEQTMQYLGXAVATIRMVGVGLNGGGFSQWF*
BS_KBA_SWE21_205mDRAFT_100774382F055661GGTGGMVLNLNIDFGLAEATPKKLELLQAVFDAHDMAARNNQNASSGAAVNAFFGSAQLTNGIASAILTLGDAHGPIGPARYVYERFDERALKSAIGAGMKIPGFGNSFFKDRID
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.