NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SI36aug09_100mDRAFT_1013656

Scaffold SI36aug09_100mDRAFT_1013656


Overview

Basic Information
Taxon OID3300000238 Open in IMG/M
Scaffold IDSI36aug09_100mDRAFT_1013656 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 100m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1172
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet 36, Vancouver Island, BC, Canada
CoordinatesLat. (o)48.5663346Long. (o)-123.5193257Alt. (m)Depth (m)100
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059063Metagenome134N
F103042Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
SI36aug09_100mDRAFT_10136561F103042AGGAMEKLYTKSKDYWMDVQLNTTECDKCGVDVDPMSSYPIKVENKGYPNPNGFIFVCGSCKNK
SI36aug09_100mDRAFT_10136563F059063AGGAMYKMNLKNLYGTFLQNGNSPEAFIANVIYERYGAKRKKMLQGLYNIINGGPRHYWGKCNVTFAPFQMETILATAENDNMWSQGRTKEIDIHNLEFYA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.