NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SI34jun09_10mDRAFT_1011085

Scaffold SI34jun09_10mDRAFT_1011085


Overview

Basic Information
Taxon OID3300000224 Open in IMG/M
Scaffold IDSI34jun09_10mDRAFT_1011085 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1790
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet 34, Vancouver Island, BC, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005352Metagenome / Metatranscriptome403Y
F025150Metagenome / Metatranscriptome203Y
F035836Metagenome / Metatranscriptome171Y
F062792Metagenome / Metatranscriptome130N

Sequences

Protein IDFamilyRBSSequence
SI34jun09_10mDRAFT_10110851F035836AGGMKKDRFDLETAIMSAWNTSEDIDLIYHNTDSLKLNAKDCDTLQNQLLGLKYINDLRMSKVWNVFEE
SI34jun09_10mDRAFT_10110854F062792GAGGMTPQEREAHKRKWRMASHFIYHTHTDLRSESKEWCKKNCEQHEWDLKQFTDIYGDTIRFEVEEHFNEFSKWYRTRG*
SI34jun09_10mDRAFT_10110855F005352GAGGMIHPALDKPYIQLICNPYEHETSVNTRITIDVMQKDLSRTEMLEVMQSFMKAMGYGFTQNEVLCIEEYEK*
SI34jun09_10mDRAFT_10110857F025150N/AYDTFIDECIIALFPENAVYDINIRFKKFADKTGTHAGFCMGDDIESSIIVGTHWKYEDDEVVAYEPHEIASNLAHELTHAKQFCKNQINMIDHVWKHNEMTIDCVELEYAETPWEVEAYAYEAILTDLLWENV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.