Scaffold BBAY59_c10048426

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BBAY59_c10048426

Scaffold BBAY59_c10048426

Overview

Basic Information
Taxon OID	3300000165 Open in IMG/M
Scaffold ID	BBAY59_c10048426 Open in IMG/M
Source Dataset Name	Delisea pulchra's surface microbial communities from Botany Bay, Sydney, Australia - BBAY59_SOAP_k21_Abyss_k55_GAA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	865
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra's Surface → Delisea Pulchra's Surface Microbial Communities From Botany Bay, Sydney, Australia

Source Dataset Sampling Location
Location Name	Botany Bay, Sydney, NSW, Australia
Coordinates	Lat. (^o)	-33.991017	Long. (^o)	151.232433	Alt. (m)		Depth (m)	7
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037503	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
BBAY59_100484261	F037503	N/A	EVELPIGLGGFTAYQPLTNSECHYTAAAVRLWVLRSTAERGTTQTIS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.