NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SI53jan11_200mDRAFT_c1006960

Scaffold SI53jan11_200mDRAFT_c1006960


Overview

Basic Information
Taxon OID3300000151 Open in IMG/M
Scaffold IDSI53jan11_200mDRAFT_c1006960 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 53 01/11/11 200m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)3285
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (81.82%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet 53, Vancouver Island, BC, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005749Metagenome391Y
F012582Metagenome / Metatranscriptome279Y

Sequences

Protein IDFamilyRBSSequence
SI53jan11_200mDRAFT_10069602F012582N/AMTEFHKKLKHLSTTMIQWAEENKIRTKRNGNYEIPQRNGIDWKFDFTFVTKLDFMLADGLDDKLKKKEMEMCNELYSYYRQCYMRK*
SI53jan11_200mDRAFT_10069607F005749AGTAGGLVRVLNIYLTRKMSQIMNKKSWLLTMSFDEHDGSPNNIKTLYHGRAKRDMVKDMNLFQDMNEHLVLALVEIDEKSTYDKIIDKEDTEEMFFMDSKKNWNDGKTYEDLKDEVLEEILTGSLINGDMGYA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.