Basic Information | |
---|---|
Taxon OID | 3300000121 Open in IMG/M |
Scaffold ID | TDF_OR_ARG04_113mDRAFT_c1006958 Open in IMG/M |
Source Dataset Name | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1492 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | MC site, Ushuaia Bay, Tierra del Fuego, Argentina | |||||||
Coordinates | Lat. (o) | -54.810872 | Long. (o) | -68.295525 | Alt. (m) | Depth (m) | 11.3 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005817 | Metagenome / Metatranscriptome | 389 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
TDF_OR_ARG04_113mDRAFT_10069585 | F005817 | N/A | MRSNLLSRLKPEFKQGLEDNKTRYPASINDLEFVLSQLTFYNDLSVNQVLNLFLFSDMQYLDRKNFDWRYGEDIF |
⦗Top⦘ |