| Basic Information | |
|---|---|
| Taxon OID | 3300000116 Open in IMG/M |
| Scaffold ID | DelMOSpr2010_c10015973 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3758 |
| Total Scaffold Genes | 13 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (76.92%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Microbial Observatory off the coast of Delaware, USA | |||||||
| Coordinates | Lat. (o) | 38.848917 | Long. (o) | -75.1076 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011355 | Metagenome / Metatranscriptome | 292 | N |
| F026156 | Metagenome / Metatranscriptome | 199 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| DelMOSpr2010_1001597312 | F011355 | N/A | MPSRLIKGYQKEKDLEDKVFEIEMKSLVVIVVLLAGPDNLEKNYYPVDTEDNCTVVGQRIIEQIAKXXXNIGEHQGWYTLDDKLVIGHYCNVK* |
| DelMOSpr2010_100159732 | F026156 | AGG | MKRTKKLPWPKLKAIENRFIDLRFDGVEHAINSIGLKNKKQHVYGGTGFYVRKNKPLTRKEIRQSDEEFQDSYNNYEENAVYTGKAYLRMSREYRGKKYNYLVTVEDLNETE* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |