| Basic Information | |
|---|---|
| Taxon OID | 3300000116 Open in IMG/M |
| Scaffold ID | DelMOSpr2010_c10012476 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4346 |
| Total Scaffold Genes | 13 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (69.23%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Microbial Observatory off the coast of Delaware, USA | |||||||
| Coordinates | Lat. (o) | 38.848917 | Long. (o) | -75.1076 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001942 | Metagenome / Metatranscriptome | 613 | Y |
| F008595 | Metagenome / Metatranscriptome | 331 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| DelMOSpr2010_100124762 | F008595 | AGGAG | MSNEENKMENQEPVIITFNGTEYRAADLNEDQMAIAAKLNVAGKKLARLQEAYDDYVITNEYKNICIESFDRAVNVEDVAEVVEEE* |
| DelMOSpr2010_100124766 | F001942 | N/A | MPRKTSDQHQANSRLGALGESLVQTFLLEYADFCFPTQEKHPADLIVEFGNAIYTVQVKSRRATKEKKFVFAAENSRAMSDTYKNYTCDILAFVFFFDSQKRIMFKSNTSSQNYFTFDKKIITDTMELDSLQESLDTLSAVPVLNPII* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |