NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ICChiseqgaiiDRAFT_c2312397

Scaffold ICChiseqgaiiDRAFT_c2312397


Overview

Basic Information
Taxon OID3300000033 Open in IMG/M
Scaffold IDICChiseqgaiiDRAFT_c2312397 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Iowa, Continuous Corn soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1051
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m).1016
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018956Metagenome / Metatranscriptome232Y
F023245Metagenome / Metatranscriptome211Y

Sequences

Protein IDFamilyRBSSequence
ICChiseqgaiiDRAFT_23123971F023245AGGMXPVRGSLRNQNVFRRANERLLAAVSDRIDDARQIPFLCECLDPACRSTVQLTIEQFRELRDERIRFAIVTGHPTMDDERIVAVDGDVTIVEKAA*
ICChiseqgaiiDRAFT_23123972F018956AGGAGVQECRRCAEEVDWAFRYCPWCGAPLRIKVTELFEGAEGKALRVSRYFADEEREPEVRVSLWSETLGRNLRAEAAVSLSDEEAARLSSFLAEAPAPDEAQTL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.