NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold PheDRAFT_GXW9OCQ03GDLC6.20596

Scaffold PheDRAFT_GXW9OCQ03GDLC6.20596


Overview

Basic Information
Taxon OID2228664014 Open in IMG/M
Scaffold IDPheDRAFT_GXW9OCQ03GDLC6.20596 Open in IMG/M
Source Dataset NameContaminated soil microbial communities from Tipperary, Ireland - enriched with phenanthrene, cDNA isolated at day 31
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Liverpool
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)511
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Contaminated Soil → Contaminated Soil Microbial Communities From Tipperary, Ireland, In A Timber Treatment Facility

Source Dataset Sampling Location
Location NameIreland: Spaights timber treatment facility, Tipperary
CoordinatesLat. (o)52.512199Long. (o)-8.226278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024800Metagenome / Metatranscriptome204Y

Sequences

Protein IDFamilyRBSSequence
PheDRAFT_00075940F024800GAGGVARGQRTAKSGGCPRANGGDAETKSRACLHQVRRPVAQPSAQAGQEASLEIQRARAAGRPCYEAERTPLAVENSVGKPAADPTQGAQCRPGKESVASSHPHFGPCPAARPGR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.