Basic Information | |
---|---|
Taxon OID | 2228664014 Open in IMG/M |
Scaffold ID | PheDRAFT_GXW9OCQ03FZNN7.12884 Open in IMG/M |
Source Dataset Name | Contaminated soil microbial communities from Tipperary, Ireland - enriched with phenanthrene, cDNA isolated at day 31 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Liverpool |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 512 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Contaminated Soil → Contaminated Soil Microbial Communities From Tipperary, Ireland, In A Timber Treatment Facility |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ireland: Spaights timber treatment facility, Tipperary | |||||||
Coordinates | Lat. (o) | 52.512199 | Long. (o) | -8.226278 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F024800 | Metagenome / Metatranscriptome | 204 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
PheDRAFT_00071390 | F024800 | GAGG | VARGQRTAKSGGRPRANGGDAETKSRACLRQVRRPVAQPPAQAGLEASLELQRARAAERPCYEAERTPLAVENSVGKPAANKQGAQCRPGKESVANSHTHFGPCLAARPGRG |
⦗Top⦘ |