NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2228798801

Scaffold 2228798801


Overview

Basic Information
Taxon OID2228664000 Open in IMG/M
Scaffold ID2228798801 Open in IMG/M
Source Dataset NamePanchlora_midgut_metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)822
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Midgut → Unclassified → Panchlora Sp. Gut → Panchlora Sp. Gut Microbial Communities From Gamboa, Panama

Source Dataset Sampling Location
Location NamePanama
CoordinatesLat. (o)9.116667Long. (o)-79.7Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030633Metagenome184N

Sequences

Protein IDFamilyRBSSequence
2228929762F030633N/AVTSDCSPNSRGQAISDKRRHYNCRAKYHSKRGFFGMFPTKATPLGEVCGVPRRLL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.