Basic Information | |
---|---|
Taxon OID | 2228664000 Open in IMG/M |
Scaffold ID | 2228798801 Open in IMG/M |
Source Dataset Name | Panchlora_midgut_metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 822 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Digestive System → Midgut → Unclassified → Panchlora Sp. Gut → Panchlora Sp. Gut Microbial Communities From Gamboa, Panama |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Panama | |||||||
Coordinates | Lat. (o) | 9.116667 | Long. (o) | -79.7 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030633 | Metagenome | 184 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2228929762 | F030633 | N/A | VTSDCSPNSRGQAISDKRRHYNCRAKYHSKRGFFGMFPTKATPLGEVCGVPRRLL |
⦗Top⦘ |