NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2224065270

Scaffold 2224065270


Overview

Basic Information
Taxon OID2222084008 Open in IMG/M
Scaffold ID2224065270 Open in IMG/M
Source Dataset NameColmarContigsNoOGM
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)524
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Traditional Grape Vine Soil → Traditional Grape Vine Soil Microbial Communities From Colmar, France

Source Dataset Sampling Location
Location NameColmar, France
CoordinatesLat. (o)48.081Long. (o)7.355Alt. (m)Depth (m)0 to .3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018688Metagenome / Metatranscriptome233Y

Sequences

Protein IDFamilyRBSSequence
2224307703F018688N/AVTQIADEEATRVLNAFQRDARAMLEYLLPALRQRGLYPEAQVDGWGDSRGGRGTASTVVLASPKWLKPTDKTKQLARLRLQLSDSNTWAVIVSVVAQPDQLHAWPPSDETAWWTELRELIRGQIM

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.