| Basic Information | |
|---|---|
| Taxon OID | 2222084008 Open in IMG/M |
| Scaffold ID | 2224065270 Open in IMG/M |
| Source Dataset Name | ColmarContigsNoOGM |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 524 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Traditional Grape Vine Soil → Traditional Grape Vine Soil Microbial Communities From Colmar, France |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Colmar, France | |||||||
| Coordinates | Lat. (o) | 48.081 | Long. (o) | 7.355 | Alt. (m) | Depth (m) | 0 to .3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018688 | Metagenome / Metatranscriptome | 233 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2224307703 | F018688 | N/A | VTQIADEEATRVLNAFQRDARAMLEYLLPALRQRGLYPEAQVDGWGDSRGGRGTASTVVLASPKWLKPTDKTKQLARLRLQLSDSNTWAVIVSVVAQPDQLHAWPPSDETAWWTELRELIRGQIM |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |