NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2199909260

Scaffold 2199909260


Overview

Basic Information
Taxon OID2199352004 Open in IMG/M
Scaffold ID2199909260 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2799
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (16.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, WI
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015080Metagenome / Metatranscriptome257Y
F048940Metagenome / Metatranscriptome147Y
F058096Metagenome / Metatranscriptome135Y
F063620Metagenome / Metatranscriptome129N

Sequences

Protein IDFamilyRBSSequence
2200091704F058096N/AMNAQMTVDECKVMWVVGALQRLATLGMIGPDIPLKLTPEAVDDYVMIDNHRNILFESDFEIASIFNALAKDECDEEPNPDDVEAIVDLILEYKNNRTEIVKFALSHQSI
2200091705F015080N/AMMFDLLKFEPHNIPNAIAARHKFENGWEISVVAGPGLYGRIDENTYEVGIFRPNGNLTEDVSGWNTKEEVSAMMWVLSQL
2200091706F048940AGGMTASQRMERQFFIKFISLIDEVQGKQKLPSQIVASRKSAWVKQVSNPKQKKDALTLV
2200091707F063620N/AMTDSIIPKIAYIPLEYHMSVEDFLEVWKDMEMEEEPTQEDYDTFILERGKSYFYDMRGELERHIRVALVD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.