| Basic Information | |
|---|---|
| Taxon OID | 2189573022 Open in IMG/M |
| Scaffold ID | PRSSG2_Sequence0000035312 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Puerto Rico rain forest, that decompose switchgrass - feedstock-adapted consortia SG only |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1161 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium indicum | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Soil → Soil Microbial Communities From Puerto Rico Rain Forest, That Decompose Switchgrass |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Luquillo LTER tropical forest, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 18.3724 | Long. (o) | -65.7166 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010231 | Metagenome | 306 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| PRSSG2_00398000 | F010231 | N/A | WHWLADVHSVGFAPAFTLSFHDSERSRKPPNAHSLGR |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |