NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold PRSSG2_Sequence0000006350

Scaffold PRSSG2_Sequence0000006350


Overview

Basic Information
Taxon OID2189573022 Open in IMG/M
Scaffold IDPRSSG2_Sequence0000006350 Open in IMG/M
Source Dataset NameSoil microbial communities from Puerto Rico rain forest, that decompose switchgrass - feedstock-adapted consortia SG only
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4316
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Soil → Soil Microbial Communities From Puerto Rico Rain Forest, That Decompose Switchgrass

Source Dataset Sampling Location
Location NameLuquillo LTER tropical forest, Puerto Rico
CoordinatesLat. (o)18.3724Long. (o)-65.7166Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018557Metagenome / Metatranscriptome234Y

Sequences

Protein IDFamilyRBSSequence
PRSSG2_01059190F018557GAGVYLTEPKNGRPIFFPERLVLWGNLALFLWIVLDTVAFLLYDVTGGIVFFVLTLILIYGVLHFLGCLRPCYNCIKCTHGMGRLAALYFGRRIFKDYKYNYKLPGAIFFTLYVGAFPAAFALYSTIVDFTPLKAAVFAALLAITIYSALTWRPKKPKLAQAETNNTA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.