NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GO6OHWN01D697P

Scaffold GO6OHWN01D697P


Overview

Basic Information
Taxon OID2170459013 Open in IMG/M
Scaffold IDGO6OHWN01D697P Open in IMG/M
Source Dataset NameGrass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center454 Life Sciences
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)505
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk

Source Dataset Sampling Location
Location NameRothamsted, Harpenden, UK
CoordinatesLat. (o)51.804241Long. (o)-0.372114Alt. (m)Depth (m)0 to .21
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000365Metagenome / Metatranscriptome1227Y

Sequences

Protein IDFamilyRBSSequence
N57_09157620F000365N/ALVTQKTEVSAPKNKKNAPAGESGNQRPKRRKGKLIRLDDLIPQRDVTGGHQLLFGATDTTETTNQNKEEE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.