NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold NODE_2439_length_2068_cov_9.226306

Scaffold NODE_2439_length_2068_cov_9.226306


Overview

Basic Information
Taxon OID2140918013 Open in IMG/M
Scaffold IDNODE_2439_length_2068_cov_9.226306 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2100
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameIowa, USA
CoordinatesLat. (o)41.827222Long. (o)-93.008611Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076213Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
Iowa-Corn-GraphCirc_03780060F076213GAGGMHTRASGLHAVLLAAVSLVALTGCPSAAPSPCLIQRPPLQGYTIKFDLQGAAPAGCEAVLPTTFADNWRFDGFSDRQIWVKSDSIPYPPGDDGGPQSTVLGNGTFDEAPDADNICNIPDMTQFGGEAPDFPVSGTINLSYHPRNLRFLDGARYQGSTFEGDVDATFGTCTGTYKMQGLTPSPIGLIGPCEDDSLCDPFGDPANGIFASGINPDYAVSCVKEQWVSDYLTGDPALGICFFTKPFPGLK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.