Basic Information | |
---|---|
Taxon OID | 2124908008 Open in IMG/M |
Scaffold ID | FWIREl_GJ4R3DH02GHVYM Open in IMG/M |
Source Dataset Name | Soil microbial communities from sample at FACE Site Metagenome WIR_Elev2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 515 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Wisconsin Rhinelander (WIR) | |||||||
Coordinates | Lat. (o) | 45.68 | Long. (o) | -89.63 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F012395 | Metagenome / Metatranscriptome | 281 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
FWIREl_07069070 | F012395 | N/A | ILAVVIFVSIVVTLILAVASYFAYKVREARRPKTAAELRQEGQAKVFFSEYRPEAPKQ |
⦗Top⦘ |