NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold MXSH_contig02461

Scaffold MXSH_contig02461


Overview

Basic Information
Taxon OID2088090024 Open in IMG/M
Scaffold IDMXSH_contig02461 Open in IMG/M
Source Dataset NameSample MXSH
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNational Research Council of Canada
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5274
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (28.57%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium WCE2008(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Stomach → Unclassified → Rumen → Rumen Microbial Communities Of Musk Oxen From Alaska

Source Dataset Sampling Location
Location NameFairbanks, Alaska
CoordinatesLat. (o)64.880776Long. (o)-147.869984Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076635Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
MXSH_01977330F076635AGGMIKRGTKVRVIKMDDAGGGFGWQAKQLNGRIFTVRYMDATKQIHLEETGIALIPGGGSV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.