| Basic Information | |
|---|---|
| Taxon OID | 2084038018 Open in IMG/M |
| Scaffold ID | TrFG_contig00421 Open in IMG/M |
| Source Dataset Name | Ant host-associated microbial communities from Gamboa, Panama - Trachymyrmex fungus garden |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5655 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Ant Host-Associated → Ant Host-Associated Microbial Communities From Gamboa, Panama |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Panama: Gamboa | |||||||
| Coordinates | Lat. (o) | 9.1167 | Long. (o) | -79.7 | Alt. (m) | Depth (m) | .2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000950 | Metagenome | 822 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| TrFG_01435160 | F000950 | AGG | MLEDIDDQDSPPEDVKINSASIEEIPDPIPPSGKGKGIPKLDFPLGL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |