Basic Information | |
---|---|
Taxon OID | 2084038018 Open in IMG/M |
Scaffold ID | TrFG_contig00421 Open in IMG/M |
Source Dataset Name | Ant host-associated microbial communities from Gamboa, Panama - Trachymyrmex fungus garden |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5655 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Ant Host-Associated → Ant Host-Associated Microbial Communities From Gamboa, Panama |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Panama: Gamboa | |||||||
Coordinates | Lat. (o) | 9.1167 | Long. (o) | -79.7 | Alt. (m) | Depth (m) | .2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000950 | Metagenome | 822 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
TrFG_01435160 | F000950 | AGG | MLEDIDDQDSPPEDVKINSASIEEIPDPIPPSGKGKGIPKLDFPLGL |
⦗Top⦘ |