| Basic Information | |
|---|---|
| Taxon OID | 2061766005 Open in IMG/M |
| Scaffold ID | CGUI_GFCP3IQ02HW3CD Open in IMG/M |
| Source Dataset Name | Elkhorn Slough cyanobacterial mat night |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 504 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Microbial Mats → Hypersaline Mat Water → Hypersaline Mat Water Microbial Communities From Elkhorn Slough, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Elkhorn Slough, Monterey Bay, CA | |||||||
| Coordinates | Lat. (o) | 36.82188 | Long. (o) | -121.744 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010070 | Metagenome / Metatranscriptome | 308 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| CGUI_00943930 | F010070 | N/A | QMKXRGQPHLCAGLNANMYTTCIENLESILRTDKAVVYWLKNGCMHMDATGPEIVRPCPALSICSWTANLFAQPPSLVRDGVESLCPKDPKFLPTIPQEYRSLLNPAEQQNAAATGPKSF |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |