Basic Information | |
---|---|
Taxon OID | 2038011001 Open in IMG/M |
Scaffold ID | Coalbed1142_GAKB3UI02ISJBC Open in IMG/M |
Source Dataset Name | Coalbed microbial communities from New Mexico, USA - 342 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Virginia Polytechnic Institute and State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 502 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From New Mexico, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | New Mexico | |||||||
Coordinates | Lat. (o) | 36.728056 | Long. (o) | -108.220833 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F045124 | Metagenome / Metatranscriptome | 153 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Coalbed4_61220 | F045124 | GAG | VTDDTTLQATIYETRQDVRWIKEALSEIKKANQKQDGRIADIETTIARRSGRDGALAAIVSAVVAFVVAFVSGGWLR |
⦗Top⦘ |