| Basic Information | |
|---|---|
| Taxon OID | 2013843002 Open in IMG/M |
| Scaffold ID | DCKB1_C5928 Open in IMG/M |
| Source Dataset Name | Groundwater dechlorinating microbial communities from synthetic mineral medium in Toronto, Ontario, Canada - Site contaminated with chlorinated ethenes |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1438 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Chloroethene → Bioreactor → Enriched Contaminated Groundwater → Enriched Contaminated Groundwater Dechlorinating Microbial Communities From Synthetic Mineral Medium In Toronto, Ontario, Canada (Kb-1) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Toronto, Ontario | |||||||
| Coordinates | Lat. (o) | 43.449776 | Long. (o) | -80.489086 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F091988 | Metagenome / Metatranscriptome | 107 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| DCKB1_189800 | F091988 | N/A | XXXXXXXXXXXXAQASQDALTLTLTMSGVDYEEKVSNFRATGFEKLVCNPYIVAKEPVSVMFQAYEVKAGNPTQVVYTYSLKGSTTSELTLTMDWTIGPCAPAYDESNVKAQRNPLLTTYHFEFKVPVK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |