NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JC3AJCVIAssemblies_1106445189435

Scaffold JC3AJCVIAssemblies_1106445189435


Overview

Basic Information
Taxon OID2012990006 Open in IMG/M
Scaffold IDJC3AJCVIAssemblies_1106445189435 Open in IMG/M
Source Dataset NameHot spring microbial communities from Joseph's Coat Spring Transect A, Yellowstone National Park, USA - YSTONE1 (JC3A)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1226
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Caldivirga → unclassified Caldivirga → Caldivirga sp. MU80(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park

Source Dataset Sampling Location
Location NameJoseph's Coat Spring Transect A, Yellowstone National Park, USA
CoordinatesLat. (o)44.731451Long. (o)-110.7113131Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F105516Metagenome100Y

Sequences

Protein IDFamilyRBSSequence
JC3AJCVIAssemblies_32450F105516AGGMPRAIVRVLALGRVSLNLKTFRVTASERLSVDSDGTVNCLGGDCSANGTFITLETEHPNPRELYDALKKVRVLELEVEIHGLPNWLLSRLEFLVGKPTSDKVRYTWHKMPSFGELALVLNDLNLNA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.