Basic Information | |
---|---|
Family ID | F104190 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 43 residues |
Representative Sequence | KKQVTLGFKICPKKQVILPYLESACACKNQLVPNMDNK |
Number of Associated Samples | 69 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 0.00 % |
% of genes from short scaffolds (< 2000 bps) | 0.00 % |
Associated GOLD sequencing projects | 69 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (100.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (89.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (97.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (67.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 40.91% β-sheet: 0.00% Coil/Unstructured: 59.09% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF00612 | IQ | 1.00 |
PF00762 | Ferrochelatase | 1.00 |
PF01566 | Nramp | 1.00 |
PF04535 | CASP_dom | 1.00 |
PF12899 | Glyco_hydro_100 | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG0276 | Protoheme ferro-lyase (ferrochelatase) | Coenzyme transport and metabolism [H] | 1.00 |
COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 100.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 89.00% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 8.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300020031 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028141 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028523 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032468 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032490 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032591 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032593 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032699 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032758 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032761 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032792 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032812 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032823 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032844 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032845 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032913 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032915 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032916 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032959 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033523 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033538 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0134125_121887781 | 3300010371 | Terrestrial Soil | ILGFKICPKRQVILSYLESACECACNNEVMPNMDNI* |
Ga0134121_131826391 | 3300010401 | Terrestrial Soil | RIQTLTIYSLRPKILVILGFKICPKKQVTLPYLESACACNNQLVLNVDNI* |
Ga0134123_124822711 | 3300010403 | Terrestrial Soil | IFVLYPSMYSLRPKIQVILGSKICPKKQVTLPYLESACACKNQLLPNMDNK* |
Ga0182183_10426312 | 3300015270 | Switchgrass Phyllosphere | MMRFLLFHMYSLRPKKTVVLGFKICPRKQVMLPSFESAYACKNQLVPNMGNK |
Ga0182100_10077091 | 3300015280 | Switchgrass Phyllosphere | VQTYSLGPKKQVLLGFNIYPKKQVILPYYLESACACKNQSVPNMGNK* |
Ga0182103_10296631 | 3300015293 | Switchgrass Phyllosphere | MRYSLRPKKQVILGFKICPKKHVTLPYLESACACKNQLLPNM |
Ga0182103_10633241 | 3300015293 | Switchgrass Phyllosphere | MQLKLRTPSVPKKQVTLGFKICPKKQVILPYLESAYACKNQLVPNMGSK* |
Ga0182180_10514861 | 3300015306 | Switchgrass Phyllosphere | PKKQVILGFKVCPKKQVIIPYLESACAWKNQLVPNMDNI* |
Ga0182098_10719461 | 3300015309 | Switchgrass Phyllosphere | MYSLRPKIQVILGSKICPKKQVTLPYLESACACKN |
Ga0182168_10036462 | 3300015312 | Switchgrass Phyllosphere | MLNIIAYSLRPKILVILGFKICPQKQVTLLYLESACACKNQLVP |
Ga0182168_10883251 | 3300015312 | Switchgrass Phyllosphere | YSLRPKKQVILGFKICPQKHVTLPYLESACACKNQLLPNMDNK* |
Ga0182121_10139003 | 3300015316 | Switchgrass Phyllosphere | PTYSLRPEKQVTLGFKICPKKQVILPYLESACACKNQLVPNKDNK* |
Ga0182136_10877212 | 3300015317 | Switchgrass Phyllosphere | PKKQVILGFKTCPKEQVILLFLENTCAYKNQLILNMDNK* |
Ga0182134_10429091 | 3300015324 | Switchgrass Phyllosphere | SFHPKKQIILGFEIYPKNKSLLPYLESICAYTNQLLLN* |
Ga0182134_10884242 | 3300015324 | Switchgrass Phyllosphere | MYSFRPKILVILGFKICPKKQVTLSYLESVCVCNNQLVLNV |
Ga0182114_10513581 | 3300015327 | Switchgrass Phyllosphere | MNYSFRPKKQVILDFKICPKKQVILSYLESTYACKDQLVLNMESK* |
Ga0182114_11075601 | 3300015327 | Switchgrass Phyllosphere | AFLSEMITLSVPKKQVILEFKICPKKQVILPYLESACACKNQLVPNMGNK* |
Ga0182153_10547861 | 3300015328 | Switchgrass Phyllosphere | ERKNSDCLFVLYSLRPKKQVILGFEICPKKQIILPYLESAYACKKQLVPNMGNK* |
Ga0182152_10270274 | 3300015330 | Switchgrass Phyllosphere | FVQKTYALRPKILVILAFKFCPKKHVILLYLESACACKNQLVPNMGSK* |
Ga0182131_10634111 | 3300015331 | Switchgrass Phyllosphere | YSLRPKIQVILGSKICPKKQVTLPYLESACACKNQLLPNMGNK* |
Ga0182147_10862273 | 3300015333 | Switchgrass Phyllosphere | LRPKKQATLGYKTCPKNQVILAYLENACACKNQLVSNMANK* |
Ga0182132_10173112 | 3300015334 | Switchgrass Phyllosphere | MYSLRPKIQVILGSKICPKKQVTLPYLESACACKNQLLPNM |
Ga0182132_10819702 | 3300015334 | Switchgrass Phyllosphere | SKKKVIL*FEICSKKQIILPYLESAYAYKNQIVPNMRSK* |
Ga0182132_11706481 | 3300015334 | Switchgrass Phyllosphere | ILGFKICPKKQVIFLYLESAYACKNQLVPNKDNK* |
Ga0182150_11285872 | 3300015336 | Switchgrass Phyllosphere | MQFCQKYYSLRPKKQVILGFKICPKKQVILPYLESACACKNQLVPNM |
Ga0182137_10488102 | 3300015338 | Switchgrass Phyllosphere | MLRDNYSLRPKILVILGFKICPKKQVTLLYLESACACKNQLVLNIDNI* |
Ga0182137_11551811 | 3300015338 | Switchgrass Phyllosphere | AFLSEMITLSVPKKQVSLEFKICPKKQVILPYLESACACKNQLVPNMGNK* |
Ga0182149_10052803 | 3300015339 | Switchgrass Phyllosphere | PSQKKQVILGFKICPKKQVDLPYLESACACKNQLLPNIDNK* |
Ga0182149_11435981 | 3300015339 | Switchgrass Phyllosphere | KKQVILGFKICPKKQVTLPYLESACTCKNQLLPNMGNK* |
Ga0182133_10601541 | 3300015340 | Switchgrass Phyllosphere | AGYYSNRYLLVATYSFRPKKQVILGFKICPKKQVIFLYLESAYACKNQLVPNKDNK* |
Ga0182115_10585191 | 3300015348 | Switchgrass Phyllosphere | RATPSVPKKQVILGFKIYPKKQVTLPYLENACAYKNQLLPNMGNK* |
Ga0182115_12197501 | 3300015348 | Switchgrass Phyllosphere | LRPKKQVILGFKICPKKQVPLPYLETACACNNQLLPNLGNE* |
Ga0182185_10907921 | 3300015349 | Switchgrass Phyllosphere | NYFLRPKILVILGFKICSKKQVTLLYLESAYVCKNQLVPNIDNI* |
Ga0182185_11051822 | 3300015349 | Switchgrass Phyllosphere | LHLKILVILGFKIRPKKQVTLPYLESACACKNQLVPNMDNI* |
Ga0182169_10346731 | 3300015352 | Switchgrass Phyllosphere | MYSLRPEKQVTLGFKICPKKQVILPYLESACACKNQLVP |
Ga0182169_10971431 | 3300015352 | Switchgrass Phyllosphere | SVPKKKQFTLGFKICPKKQVILFYLESACAYKNQLVPNMNNKLGQI* |
Ga0182169_11819361 | 3300015352 | Switchgrass Phyllosphere | MIYSLRLKKQVTLEFKFCSKKQVTLPYLGSVCACKNQL |
Ga0182169_12382971 | 3300015352 | Switchgrass Phyllosphere | KKQVILGFKIYPKKQVTLPYLESACKNQLLPNMSNK* |
Ga0182179_10557001 | 3300015353 | Switchgrass Phyllosphere | TQITLGFKIYSKNLIILPNLKSACSYKNQLVPNMDNK* |
Ga0182179_12588131 | 3300015353 | Switchgrass Phyllosphere | LVILAFKFYLKKHVILPYLENVYACKNQLMSNMNNK* |
Ga0182179_12763221 | 3300015353 | Switchgrass Phyllosphere | KQVILGFKICPKKQVILPYLESACAYKNQLVPNINNI* |
Ga0182167_10539061 | 3300015354 | Switchgrass Phyllosphere | QVTLGFKICPKKQVIVLYLESVFACKNQLVSNMGNK* |
Ga0182167_10788501 | 3300015354 | Switchgrass Phyllosphere | KKQVILDFKICPKKQVILPYLESTYACMNQLVSNMESK* |
Ga0182197_11022711 | 3300017408 | Switchgrass Phyllosphere | LRPEKQVTLGLKIYPKKQVILLYLESACACKNHLLPNMDNI |
Ga0182195_10011611 | 3300017414 | Switchgrass Phyllosphere | KKQVTLGFKNYSKKQVILPYLESACACKKQLVPNMDNK |
Ga0182195_10225411 | 3300017414 | Switchgrass Phyllosphere | PKKQVILGFKFCLKKQVILHYLESACACENQLLPNMENK |
Ga0182195_11631131 | 3300017414 | Switchgrass Phyllosphere | WYESFKLEMNYSFRLKKQVILDFKICPKKQVILPYLESTYACMNQLVSNMESK |
Ga0182195_11941381 | 3300017414 | Switchgrass Phyllosphere | KKQIILGFKICPKKQVTLPYLESACACKNQLLPNMDNK |
Ga0182195_12012151 | 3300017414 | Switchgrass Phyllosphere | KQVILGLKICPRKQVILLYIESAFACKNQLLPNMGYNK |
Ga0182213_11362422 | 3300017421 | Switchgrass Phyllosphere | PKKQVILGFKIYPKKQVALPYLESACACKNQLLPNMGNK |
Ga0182201_10104962 | 3300017422 | Switchgrass Phyllosphere | ADAYSLRPKKKQFTLGFKICPKKQVILFYLESACAYKNQLVPNMNNKLGQI |
Ga0182196_11409831 | 3300017432 | Switchgrass Phyllosphere | ATYSFRPKKQVILGFKICPKKQVIFLYLESAYACKNQLVPNKDNK |
Ga0182214_10962761 | 3300017440 | Switchgrass Phyllosphere | PQKQFILVFEIYPKKQVILSYLESAYACQNQLVINIGSK |
Ga0182198_10773561 | 3300017445 | Switchgrass Phyllosphere | MFLFAYSLRPKILVILGFKTCPKKQVTLPYLESACACKNQLVPN |
Ga0182198_11088961 | 3300017445 | Switchgrass Phyllosphere | MEGATMYSLRPKIQVTLGFKTCPKKQVTLCYLESACTCKNQ |
Ga0182198_11946041 | 3300017445 | Switchgrass Phyllosphere | MIYSLHPKKKFILGFKICPRKQVTLLYLESACACKNQLVPNMDNI |
Ga0182215_11645201 | 3300017447 | Switchgrass Phyllosphere | LFCTMFIQDYSLRPEKQVIVVFKICPRKQLTLPYLESACACKNQLLPNMGNK |
Ga0182216_10016556 | 3300017693 | Switchgrass Phyllosphere | LVILGFKTCLKKQVIVPYLESACACKNQLVPNMDNK |
Ga0182216_10749811 | 3300017693 | Switchgrass Phyllosphere | MKIQGYSLCPNKQVILEFKIYSRKQFILLYLESECACKNQLLPNIGNK |
Ga0182216_12215291 | 3300017693 | Switchgrass Phyllosphere | VTLGFKNCPKKQVILSYLESACASKNQLVPNMDSK |
Ga0182119_1076621 | 3300020031 | Switchgrass Phyllosphere | SLRPEKQVTLGFKICPKKQVILPYLESACACKNQLVPNMDNI |
Ga0182118_1053002 | 3300020223 | Switchgrass Phyllosphere | LRPKKQVTLGFNIYPKKQVILPYYLESACACKNQSVPNMGNK |
Ga0268342_10315041 | 3300028062 | Phyllosphere | YYSNRYLLVATYSFRPKKQVILGFKICPKKQVIFLYLESAYACKNQLVPNKDNK |
Ga0268340_10349222 | 3300028064 | Phyllosphere | MLPGQERNYSLRPKILVILGFKICPKKQVTLLYLESACACKNQLVLNID |
Ga0268326_10067781 | 3300028141 | Phyllosphere | PSQKKQVILGFKVCPKKQVILPYLESACACKNQLVPNMDNI |
Ga0268341_10084021 | 3300028154 | Phyllosphere | MLEAYSLRPKILVILAFKFCPKKHVILPYLESACACKNQLVPN |
Ga0268312_10342081 | 3300028248 | Phyllosphere | TPSIPKQVILGFKKIPKKQVILPYLESAYACKNQLVPNMVNK |
Ga0268310_10252831 | 3300028262 | Phyllosphere | PSIPKKQVTLGFKLCPEKQVILSYLESACECACNNEVMPNMDNI |
Ga0268313_10105371 | 3300028523 | Phyllosphere | MRYSLRPKKQVILGFKIYPKKQVTLPYLENACAYKNQLLPNMGN |
Ga0268313_10189861 | 3300028523 | Phyllosphere | MNYSFRPKKQVILDFKICPKKQVILSYLESTYACKDQLVLNMESK |
Ga0214488_10592453 | 3300032467 | Switchgrass Phyllosphere | MYSLRPKKQVILGLKFCPKKHVILPYLESACACKNQSA |
Ga0214488_11357521 | 3300032467 | Switchgrass Phyllosphere | LLVATYSFRPKKQVILGFKICPKKQVIFLYLESAYACKNQLVPNKDNK |
Ga0214482_10416951 | 3300032468 | Switchgrass Phyllosphere | SANFILPPSQKKQVILGFKICPKKQVILPYLESACACKNQLVPNMGNK |
Ga0214482_10510063 | 3300032468 | Switchgrass Phyllosphere | MFLFAYSLRPKILVILGFKTCPKKQVTLPYLESACACKNQLVPNMDNI |
Ga0214495_11275422 | 3300032490 | Switchgrass Phyllosphere | MMHEITVILSYSLRPKILVILGFKICPKKQVTLLYLESACACKNQ |
Ga0214490_10027231 | 3300032502 | Switchgrass Phyllosphere | SQKTQITLGFKIYSKNLIILPNLKSACSYKNQLVPNMDNK |
Ga0214490_10590081 | 3300032502 | Switchgrass Phyllosphere | SEMITLSVPKKQVILEFKICPKKQVILPYLESACACKNQLVPNMGNK |
Ga0321339_10288601 | 3300032551 | Switchgrass Phyllosphere | KKQVTLGFKICPEKQVILPYLESACACKNQLVPNMDNK |
Ga0214484_11033381 | 3300032591 | Switchgrass Phyllosphere | LVATYSFRPKNQVILGFKICPKKQVIFLDLESAYACKNQLVPNKDNK |
Ga0321338_13632071 | 3300032593 | Switchgrass Phyllosphere | VPKKQVILEFKICPKKQVILPYLESACACKNQLVPNMGNK |
Ga0214497_10271301 | 3300032689 | Switchgrass Phyllosphere | MQHLISDRKAYSLRPKKQVILGFKIYPKKQVTLPYLESAYKNQLLPNMSNK |
Ga0214497_10308671 | 3300032689 | Switchgrass Phyllosphere | KKQVTLGFKICPKKQVILPYLESAWACACKNQLVSNMDNK |
Ga0214499_12017701 | 3300032697 | Switchgrass Phyllosphere | LVILGFKICPKKQVALLYLESACACNNQLVPNMDNI |
Ga0214494_10240611 | 3300032699 | Switchgrass Phyllosphere | KKQVTLGFKICPKKQVILPYLESACACKNQLVPNMDNK |
Ga0314746_10748211 | 3300032758 | Switchgrass Phyllosphere | LRPKKQVILGFKICPQKHVTLPYLESACACKNQLLPNMDNK |
Ga0314733_10541432 | 3300032761 | Switchgrass Phyllosphere | IQVILGFKICPKKQVTLPYLESACACKNQLLPNMGNK |
Ga0314733_10581391 | 3300032761 | Switchgrass Phyllosphere | QTEKPTHFVPKKQVILGFKIYPKKQVTLLYLKSACKNQLLPNMGNK |
Ga0314744_10704531 | 3300032792 | Switchgrass Phyllosphere | KQVILRFKICPKKQVTLPYLESACACTNQLLPSIGNK |
Ga0314745_10200382 | 3300032812 | Switchgrass Phyllosphere | QHTPSVPKKQVILGFKICPKKQVIFLYLESAYACKNQLVPNKDNK |
Ga0314723_10337271 | 3300032823 | Switchgrass Phyllosphere | KKQVILGFKICPKKQVTLPYLESACACKNQLLPNIGNK |
Ga0314743_10014093 | 3300032844 | Switchgrass Phyllosphere | HTLPPSQKTQITLGFKIYSKNLIILPNLESAYSYKNQLVPNMDNK |
Ga0314727_10218171 | 3300032845 | Switchgrass Phyllosphere | PKKQVILRFKICPKKQVTLPYLESACACTNQLLPNIGNK |
Ga0314739_10830872 | 3300032913 | Switchgrass Phyllosphere | LRPEKQVTLGFKICPKKQVILPYLESACACKNQLVPNIDNK |
Ga0314749_10689791 | 3300032915 | Switchgrass Phyllosphere | MMHEITVILSYSLHPKILVILGFKICPKKQVTLLYLESACACKNQLVPNMDN |
Ga0314734_10634141 | 3300032916 | Switchgrass Phyllosphere | LISDRKAYSLRPKKQVILGFKIYPKKQVTLPYLESACKNQLLPNMSNK |
Ga0314734_10665341 | 3300032916 | Switchgrass Phyllosphere | MYSLRPKIQVILGSKICPKKQVTLPYLESACACKNQLL |
Ga0314741_11537681 | 3300032934 | Switchgrass Phyllosphere | KQVTLGFNIYPKKQVILPYYLESAYACKNQSVPNMGNK |
Ga0314738_10762521 | 3300032959 | Switchgrass Phyllosphere | RKRVTLEFKICPKKQVILPYSESACACKNQLVPNMGNK |
Ga0314768_11255111 | 3300033523 | Switchgrass Phyllosphere | VILGFKICPKKQVTLPYLESACACKNQLLPNIGNK |
Ga0314755_11285831 | 3300033538 | Switchgrass Phyllosphere | KKQVTLGFKICPKKQVIQPYLESACACKNQLVPNMDNK |
⦗Top⦘ |