NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102149

Metagenome / Metatranscriptome Family F102149

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102149
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 48 residues
Representative Sequence GHAQSKYHEAGKRLDKFGTKLERAVEEQEELEGETVLELPGVAADAA
Number of Associated Samples 87
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.98 %
% of genes near scaffold ends (potentially truncated) 99.02 %
% of genes from short scaffolds (< 2000 bps) 91.18 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.373 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.608 % of family members)
Environment Ontology (ENVO) Unclassified
(32.353 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.941 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.00%    β-sheet: 0.00%    Coil/Unstructured: 56.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF03464eRF1_2 11.88
PF07992Pyr_redox_2 4.95
PF04343DUF488 4.95
PF01544CorA 1.98
PF08241Methyltransf_11 0.99
PF02622DUF179 0.99
PF00676E1_dh 0.99
PF06202GDE_C 0.99
PF10576EndIII_4Fe-2S 0.99
PF00903Glyoxalase 0.99
PF00440TetR_N 0.99
PF13683rve_3 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG3189Uncharacterized conserved protein YeaO, DUF488 familyFunction unknown [S] 4.95
COG0598Mg2+ and Co2+ transporter CorAInorganic ion transport and metabolism [P] 1.98
COG05672-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymesEnergy production and conversion [C] 0.99
COG1071TPP-dependent pyruvate or acetoin dehydrogenase subunit alphaEnergy production and conversion [C] 0.99
COG1678Putative transcriptional regulator, AlgH/UPF0301 familyTranscription [K] 0.99
COG3408Glycogen debranching enzyme (alpha-1,6-glucosidase)Carbohydrate transport and metabolism [G] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.37 %
UnclassifiedrootN/A18.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000880|AL20A1W_1010997Not Available984Open in IMG/M
3300000886|AL3A1W_1098908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300001361|A30PFW6_1361028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium773Open in IMG/M
3300001361|A30PFW6_1361028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium773Open in IMG/M
3300002908|JGI25382J43887_10496101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300004479|Ga0062595_100087314All Organisms → cellular organisms → Bacteria1604Open in IMG/M
3300004479|Ga0062595_100659245All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300005171|Ga0066677_10306811Not Available907Open in IMG/M
3300005177|Ga0066690_10085289All Organisms → cellular organisms → Bacteria2005Open in IMG/M
3300005181|Ga0066678_10426124All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300005181|Ga0066678_10479983All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300005343|Ga0070687_100721551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300005406|Ga0070703_10040512All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300005445|Ga0070708_101208616All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300005458|Ga0070681_11964821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300005471|Ga0070698_101948904All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300005530|Ga0070679_100899075All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300005536|Ga0070697_101701473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300005540|Ga0066697_10167884All Organisms → cellular organisms → Bacteria1300Open in IMG/M
3300005546|Ga0070696_101771497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300005553|Ga0066695_10144138Not Available1481Open in IMG/M
3300005553|Ga0066695_10786489All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300005554|Ga0066661_10355278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria897Open in IMG/M
3300005557|Ga0066704_10064561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2344Open in IMG/M
3300005559|Ga0066700_10479889Not Available870Open in IMG/M
3300005561|Ga0066699_10697152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300005566|Ga0066693_10059078Not Available1301Open in IMG/M
3300005575|Ga0066702_10920950All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005614|Ga0068856_101012689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria849Open in IMG/M
3300006031|Ga0066651_10667200All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300006046|Ga0066652_100973041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium807Open in IMG/M
3300006573|Ga0074055_11819884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria645Open in IMG/M
3300006800|Ga0066660_11413553All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300006804|Ga0079221_11140165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300006854|Ga0075425_102687780All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300009089|Ga0099828_11701172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria555Open in IMG/M
3300009137|Ga0066709_100043540All Organisms → cellular organisms → Bacteria4965Open in IMG/M
3300009137|Ga0066709_102479247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300009147|Ga0114129_11710545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria767Open in IMG/M
3300009147|Ga0114129_11769074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium752Open in IMG/M
3300010042|Ga0126314_11400820Not Available525Open in IMG/M
3300010337|Ga0134062_10167202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales987Open in IMG/M
3300010400|Ga0134122_10308448Not Available1361Open in IMG/M
3300010401|Ga0134121_10300822Not Available1420Open in IMG/M
3300011107|Ga0151490_1187958Not Available1001Open in IMG/M
3300012189|Ga0137388_10514328Not Available1112Open in IMG/M
3300012201|Ga0137365_10826439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300012204|Ga0137374_10806544Not Available696Open in IMG/M
3300012206|Ga0137380_11052293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria694Open in IMG/M
3300012207|Ga0137381_11684575Not Available524Open in IMG/M
3300012208|Ga0137376_10167424All Organisms → cellular organisms → Bacteria1895Open in IMG/M
3300012208|Ga0137376_11665836Not Available529Open in IMG/M
3300012285|Ga0137370_10312642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria940Open in IMG/M
3300012285|Ga0137370_10585460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M
3300012350|Ga0137372_10297914Not Available1251Open in IMG/M
3300012350|Ga0137372_10800134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300012353|Ga0137367_10067347All Organisms → cellular organisms → Bacteria2665Open in IMG/M
3300012353|Ga0137367_10844621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300012360|Ga0137375_10312442Not Available1415Open in IMG/M
3300012360|Ga0137375_10364104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1278Open in IMG/M
3300012913|Ga0157298_10166839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria675Open in IMG/M
3300012958|Ga0164299_10013678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3117Open in IMG/M
3300013296|Ga0157374_10023610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5503Open in IMG/M
3300013764|Ga0120111_1078323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria794Open in IMG/M
3300015374|Ga0132255_105359591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300015374|Ga0132255_105962504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300017654|Ga0134069_1100492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria943Open in IMG/M
3300018058|Ga0187766_10573538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria767Open in IMG/M
3300018433|Ga0066667_10095737All Organisms → cellular organisms → Bacteria1960Open in IMG/M
3300018433|Ga0066667_11054068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria702Open in IMG/M
3300018482|Ga0066669_11472451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M
3300019873|Ga0193700_1069502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300019876|Ga0193703_1060821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300019877|Ga0193722_1091644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria736Open in IMG/M
3300019999|Ga0193718_1012200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1889Open in IMG/M
3300020002|Ga0193730_1101911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria799Open in IMG/M
3300020015|Ga0193734_1071432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300022694|Ga0222623_10091741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1180Open in IMG/M
3300022756|Ga0222622_10003387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6912Open in IMG/M
3300025899|Ga0207642_10004338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4572Open in IMG/M
3300025910|Ga0207684_10452101Not Available1103Open in IMG/M
3300025918|Ga0207662_10791076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria668Open in IMG/M
3300025960|Ga0207651_12025570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300026078|Ga0207702_10928408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria863Open in IMG/M
3300026095|Ga0207676_12144759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300026527|Ga0209059_1226838All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes626Open in IMG/M
3300026530|Ga0209807_1132062Not Available991Open in IMG/M
3300027882|Ga0209590_10138979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1495Open in IMG/M
3300028379|Ga0268266_10980100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300028718|Ga0307307_10023661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1713Open in IMG/M
3300028718|Ga0307307_10229231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300028720|Ga0307317_10312671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300028799|Ga0307284_10149107Not Available901Open in IMG/M
3300028802|Ga0307503_10685036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300028819|Ga0307296_10426135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria725Open in IMG/M
3300028819|Ga0307296_10812900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300028824|Ga0307310_10005556All Organisms → cellular organisms → Bacteria4774Open in IMG/M
3300028828|Ga0307312_11113341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300028875|Ga0307289_10470929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300028878|Ga0307278_10070985Not Available1570Open in IMG/M
3300028885|Ga0307304_10293708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria716Open in IMG/M
3300032180|Ga0307471_100313027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1663Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.61%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil16.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.88%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost4.90%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.96%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000880Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000886Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001361Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013764Permafrost microbial communities from Nunavut, Canada - A28_35cm_6MEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300019876Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AL20A1W_101099723300000880PermafrostAQSKYHEAGKRLDKFGTKLERAVEEQRELDGETVLELPGVAADAA*
AL3A1W_109890823300000886PermafrostVGTHLGHAQSKYHEAGKRLDKFGTKLERAVEEQEEVELEGETVLELPSVAADAA*
A30PFW6_136102813300001361PermafrostHLGHAQSKYHEAGKRLDKFGTKLERAVEEQEELEGETVLELPGFAADAA*
A30PFW6_136102823300001361PermafrostMHSKYHEAGKRLDKFGTKLERAVEEQEELEGETVLELPGVAADAA*
JGI25382J43887_1049610123300002908Grasslands SoilSKYHEAGKRXDKFETKLERAVEEQEELEGETVLELPGVAADAA*
Ga0062595_10008731413300004479SoilHAQSKYHEAGKRLDKFGTKLERAVEEQRELEGETVLELPGVSADAA*
Ga0062595_10065924523300004479SoilKVGTHLGHAQSKYHEAGKRLDKFGTKLERAVEEQEELEGETVLELPGVSADAA*
Ga0066677_1030681113300005171SoilGTHLGHAQSSYQRADKHMDRFGTKLERAIEEQEELEGEAVLELPRSADAA*
Ga0066690_1008528913300005177SoilADDFDKVGTHIGHAQSKYHEASKRLDRFETKLERAVEEQGELVESDTVLELPGVSADAA*
Ga0066678_1042612413300005181SoilFDKFAEDFDLIGTHLGRAHSKFSDADKRLNKLETKLEQATEEYDELEGETVLELPSADAA
Ga0066678_1047998313300005181SoilFADDFDKIGTHLGHAQSKHHEAGKRLDKFETKLERAVEEQEELEGETVLELPGVAADAA*
Ga0070687_10072155123300005343Switchgrass RhizosphereKIGTHIGHAQSKHHEAGKRLDKFGTKLERAVEEQEELEGEAVLELPGIAADAA*
Ga0070703_1004051223300005406Corn, Switchgrass And Miscanthus RhizosphereKVGTHLGHAHSKYHDAGKRLDKFGTKLERAVEEQGEIEGETVLELPGVSADAA*
Ga0070708_10120861613300005445Corn, Switchgrass And Miscanthus RhizosphereHLGHAQSKYHEAGKRLDRFGTKLERAAEDQGEIEAEAVLELPGVSGLSADAA*
Ga0070681_1196482123300005458Corn RhizosphereTHIQHAQSKYHEATKRLDRFETKLERAVEEQEELEGETVLELPGVSADAA*
Ga0070698_10194890423300005471Corn, Switchgrass And Miscanthus RhizosphereFDKVGTHLGHAQSKYHEAGKRLDKFGTKLERAVEEQEELEGETVLELPGVAADAA*
Ga0070679_10089907523300005530Corn RhizosphereFADDFDKVGTHIGHAQSKYHEAGKRLDKFGTKLERAVEERRELEGETVLELPGVSADAA*
Ga0070697_10170147323300005536Corn, Switchgrass And Miscanthus RhizosphereSKFAAADRRLDRFETRLARAADDQEELESETVLELPGAAA*
Ga0066697_1016788413300005540SoilDDFDKIGTHLGHAQSKYHEAGKRLDRFETKLERAVEERGELEGEAVLELPGVADAA*
Ga0070696_10177149713300005546Corn, Switchgrass And Miscanthus RhizosphereTHIQHAQSKYHGATKRLDRFETKLERAVEEQGELEGETILELPGVSVDAA*
Ga0066695_1014413823300005553SoilKYHEAGKRLDKFGTKLERAVEEQEELEGETVLELPGVAADAA*
Ga0066695_1078648913300005553SoilGTHLGHAQSKYHEAGKRLDKFETKLERAVEEQEELEGETLLELPGVAAADAA*
Ga0066661_1035527823300005554SoilHIGHAQSKHHEAGKRLDRLETKLERAVEEQEELEGETVLELPGVAADAA*
Ga0066704_1006456143300005557SoilKRLDKFETKLDRAVEEQEELEGETVLELPGVAADAA*
Ga0066700_1047988913300005559SoilAQSKYHDAGKRLDRFETKLERAAEEQQEFEAETVLELPGVSADAA*
Ga0066699_1069715213300005561SoilKYHEAVKRLDRFETKLERAVEEQGELEGETVLELPGVTVDAA*
Ga0066693_1005907813300005566SoilKYHEASKRLDRFETKLERAVEEQGELESETVLELPGVSADAA*
Ga0066702_1092095013300005575SoilQRDFDRFADDFDKIGTHIGHAQSKHHEAGKRLDRLETKLERAVEEQEELEGETVLELPGVSADAA*
Ga0068856_10101268913300005614Corn RhizosphereQSKYHEATKRLDRFETKLERAVEEQEELEGETVLELPGVSADAA*
Ga0066651_1066720013300006031SoilGTHIGHAQSKYHEASKRLDRFETKLERAVEEQGELETETVLELPGVSADAA*
Ga0066652_10097304123300006046SoilHEATKRLDRFETKLERAVEEQGELEAETVLELPGVSADAA*
Ga0074055_1181988423300006573SoilGHAQSKYHEAGKRLDKFGTKLERAVEEQGEIEGETVLELPGVSADAA*
Ga0066660_1141355313300006800SoilTHLGHAQSSYQRADKHLDRFETKLERAVEEQEELEGETVLELPDVSVDAA*
Ga0079221_1114016513300006804Agricultural SoilKRLDRLGTKLERAAEERGEIVEAETLLELPSVSADAA*
Ga0075425_10268778023300006854Populus RhizosphereDFDKIGTHLGHAQSKYHEAGKRLDRLETKLERAVEERAELELEGETVLELPGVSADAA*
Ga0099828_1170117213300009089Vadose Zone SoilTHLGHAQSKYHEAGKRLDRFGTKLERAVEEQEELEGETVLELPGVAADAA*
Ga0066709_10004354013300009137Grasslands SoilFDKVGTHIGHAQSKYHEAGKRLDRFETKLERAVEEREELEGETVLELPGVSADAA*
Ga0066709_10247924723300009137Grasslands SoilQSKYHEAGKRLDKFGTKLERAVEEQDELEGETVLELPGVAADAA*
Ga0114129_1171054513300009147Populus RhizosphereFDKIGTHLGHAQSKYHEAGKRLDRFETKLDRAAEEQEELAGETLLELPGVSADAA*
Ga0114129_1176907413300009147Populus RhizosphereRFGSKLERAVEEQEELESEAVVELQELPGFSADAA*
Ga0126314_1140082013300010042Serpentine SoilTHIGHAQSKYHEAGKRLDRFGSKLERAVEEQEELEGEAVVELQELPAA*
Ga0134062_1016720213300010337Grasslands SoilTHLGHAQSKYHEAGKRLDKFETKLERAVEERAELEGEAVLELPGVADAA*
Ga0134122_1030844823300010400Terrestrial SoilDKVGTHLGHAQSKYHEAGKRLDKFGTKLERAVEEQGEIEGETVLELPGVSADAA*
Ga0134121_1030082213300010401Terrestrial SoilYHDAGKRLDKFGTKLERAVEEQGEIEGETVLELPGVSADAA*
Ga0151490_118795823300011107SoilDDFDKVGTHLGHAQSKYHEAGKRLDKFGTKRERAVEEQGEIEGETVLELPGVSADAA*
Ga0137388_1051432813300012189Vadose Zone SoilRGYVGGVRRDFDRLADDCDKVGTHIGHAESKYHEAGKRLDKFGTKLERAVEEQEELEGETVLELPGVAADAA*
Ga0137365_1082643923300012201Vadose Zone SoilDDFDKIGTHIGHAQSKYHEAGKRLDRLETKLERAAEDRGEIEEADTLLELPSVSVDAA*
Ga0137374_1080654423300012204Vadose Zone SoilDRFADDFDKVGTHIGHAQSKYHEAMKRLDRFETKLERAVEERGELEGETVLELPGVSADAA*
Ga0137380_1105229323300012206Vadose Zone SoilYHEAGKRLDRLETKLERAAEEKEELEGDTVLELPGVSADAA*
Ga0137381_1168457523300012207Vadose Zone SoilFADDFDKVGTHLGHAQSKYHEAGKRLDKFETKLERAVEEREELEGETVLELPGVAADAA*
Ga0137376_1016742433300012208Vadose Zone SoilFDKVGTHLGHAQSKYHEAGKRLDKFGTKLARAVEEQEELEGETVLELPGVAADAA*
Ga0137376_1166583623300012208Vadose Zone SoilFADDFDKVGTHIGHAQSKYHEASKRLDRFETKLERAVEEQGELETETVLELPGVSADAA*
Ga0137370_1031264213300012285Vadose Zone SoilKVGTHLGHAQSKYHEAGKRLDKFGTKLERAVEEQGEIEGETVLELPGVSADAA*
Ga0137370_1058546023300012285Vadose Zone SoilHAQSKYHAAGKRLDRFETKLERAVEERAEVVLEESESVLELPTVAADAA*
Ga0137372_1029791413300012350Vadose Zone SoilKYHEAGKRLDRLETKLERAAEEQEELEGETVLELPGVSADAA*
Ga0137372_1080013413300012350Vadose Zone SoilHLGHAQSKYHEAGKRLDKFGTKLERAVEEQEELEGETVLELPGVAADAA*
Ga0137367_1006734713300012353Vadose Zone SoilDFDKIGTHIGHAQSKYHEAGKRLDRLETKLERAVEEQEELEGETLLELPSVSVDAA*
Ga0137367_1084462123300012353Vadose Zone SoilFDKVGTHIGHAQSKYHEAAKRLDRFETKLERAVEEQQEVEAETVLELPGVSADAA*
Ga0137375_1031244223300012360Vadose Zone SoilHIGHAQSKYHEAGKRLDKFGTKLERAVEEQRELEGESVLELPGVSADAA*
Ga0137375_1036410433300012360Vadose Zone SoilAAKRLDRFETKLERAVEEQGELEGETVLELPGVSADAA*
Ga0157298_1016683913300012913SoilKYHTAGKRLDRLETKLERAVEEQRELEGETVLELPGVSADAA*
Ga0164299_1001367813300012958SoilTHLGHAQSKYHEAGKRLDKFGTKLERAVEEQGEIEGETVLELPGVSADAA*
Ga0157374_1002361083300013296Miscanthus RhizosphereGKRLDKFGTKLERAVEEQGEIEGETVLELPGVSADAA*
Ga0120111_107832323300013764PermafrostADDFDKVGTHLGHAQSKYHEAGKRLDKFGTKLERAVEEQEEVELEGETVLELPGVAADAA
Ga0132255_10535959123300015374Arabidopsis RhizosphereHAQSKYHEATKRLDRFETKLERAVEEQGELEGETVLELPGLSADAA*
Ga0132255_10596250413300015374Arabidopsis RhizosphereQSKYHEATKRLHRFETKLERAVEEQEELEGETVLELPGVSADAA*
Ga0134069_110049223300017654Grasslands SoilGTHIGHAQSKYHEAGKRLDRFETKLERAVEEREELEGETVLELPGVSVDAA
Ga0187766_1057353813300018058Tropical PeatlandIGHAQSKYHEAVKRLDRFETKLERAVDETHEVESNTVLELPGVPDAA
Ga0066667_1009573713300018433Grasslands SoilGKRLDKFETKLERAVEEQEELEGETVLELPGVAADAA
Ga0066667_1105406813300018433Grasslands SoilKRLDKFETKLERAVEEQEELEGETVLELPGVAAADAA
Ga0066669_1147245123300018482Grasslands SoilGHAQSKYHEAGKRLDKFGTKLERAVEEQEELEGETVLELPGVAADAA
Ga0193700_106950213300019873SoilYHEAGKRLDKFGTKLERAVEEQEELEGETVLELPGVAADAA
Ga0193703_106082113300019876SoilHLGHAHSKYHDAGKRLDKFGTKLERAVEEQGEIEGETVLELPGVSADAA
Ga0193722_109164423300019877SoilGKRLDKFGTKLERAVEEQRELEGETVLELPGVSADAA
Ga0193718_101220033300019999SoilYHDAGKRLDKFETKLERAVEEQGEIEGETVLELPGVSADAA
Ga0193730_110191123300020002SoilEAGKRLDKFGTKLERAVEEQEELEGETVLELPGVAADAA
Ga0193734_107143223300020015SoilKAGKRLDKFGTKLERAVEEQRELEGETVLELPGVSADAA
Ga0222623_1009174113300022694Groundwater SedimentHAQSKYHEAGKRLDKFESKLERAVEEQEVLETETVLELPGVAADAA
Ga0222622_1000338783300022756Groundwater SedimentKYHEAGKRLDKFGTKLERAVEEQEELEGETVLELPGVAADAA
Ga0207642_1000433813300025899Miscanthus RhizosphereLGHAHSKYHDAGKRLDKFGTKLERAVEEQGEIEGETVLELPGVSADAA
Ga0207684_1045210113300025910Corn, Switchgrass And Miscanthus RhizosphereEVVGKHLGNAQSKFAAADRRLDRFETRLARAADNQEELEGETVLELPGAAA
Ga0207662_1079107613300025918Switchgrass RhizosphereHHEAGKRLDKFGTKLERAVEEQEELEGEAVLELPGIAADAA
Ga0207651_1202557013300025960Switchgrass RhizosphereHIGHAQSKHHEAGKRLDKFGTKLERAVEEQEELEGEAVLELPGIAADAA
Ga0207702_1092840813300026078Corn RhizosphereIQHAQSKYHEATKRLDRFETKLERAVEEQEELEGETVLELPGVSADAA
Ga0207676_1214475913300026095Switchgrass RhizosphereIGHSQSKHHEAGKRLDKFGTKLERAVEEQEELEGEAVLELPGIAADAA
Ga0209059_122683823300026527SoilELQRDFDRFADDFDKIGTHIGHAQSKHHEAGKRLDRLETKLERAVEEQEELEGETVLELPGVSADAA
Ga0209807_113206213300026530SoilKYHEASKRLDRFETKLERAVEEQGELEGETVLELPGVSADAA
Ga0209590_1013897933300027882Vadose Zone SoilDKVGTHLGHAQSKYHDAGKRLDRFETKLERAAEEQQEFAAETVLELPGVSADAA
Ga0268266_1098010013300028379Switchgrass RhizosphereDFEKIGTHIGHAQSKHHEAGKRLDKFGTKLERAVEEQEELEGEAVLELPGIAADAA
Ga0307307_1002366113300028718SoilGTHIGHAQSKYHEAGKRLDKFGTKLERAVEEQRELEGETVLELPGVSADAA
Ga0307307_1022923113300028718SoilHEAGKRLDKFGTKLERAVEEQEELEGETVLELPGVAADAA
Ga0307317_1031267123300028720SoilRFADDFDKVGTHIGHAQSKYHEAGKRLDRLGTKLERAVEEQEELEGETVLELPLSADAA
Ga0307284_1014910713300028799SoilHAHSKYHDAGKRLDKFGTKLERAVEEHGEIEGDTVLELPGVSADAA
Ga0307503_1068503613300028802SoilKRLDKFGTKLERAVEEQEELEGEAVLELPGIAADAA
Ga0307296_1042613523300028819SoilYHEAAKRLDRFETKLERAVEEQGELEGETVLELPGVSADAA
Ga0307296_1081290013300028819SoilKYHDAGKRLDKFGTKLERAVEEQGEIEGDTVLELPGVSADAA
Ga0307310_1000555613300028824SoilEAGKRLDKFGTKLERAVEEQRELDGEAVLELPGVSADAA
Ga0307312_1111334123300028828SoilQRADKHLDRFGTKLERAIEDQEELEGEAVLELPGVSADAA
Ga0307289_1047092923300028875SoilDKVGTHIGHAQSKYHEAGKRLDRLGTKLERAVEEQEELEGETVLELPLSADAA
Ga0307278_1007098513300028878SoilHEAAKRLDRFETKLERAVEEQGELEGETVLELPGVSADAA
Ga0307304_1029370813300028885SoilGHAQSKYHEAGKRLDKFGTKLERAVEEQRELEGETVLELPGVSADAA
Ga0307471_10031302713300032180Hardwood Forest SoilAQSKYHEAGKRLDKFGTKLERAVEEHGEIEGETVLELPGVSADAA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.