NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082875

Metagenome / Metatranscriptome Family F082875

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082875
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 37 residues
Representative Sequence MTQETVQIVAGVLAVLLIGIIIMRRKNKKKTQEDEF
Number of Associated Samples 101
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 37.50 %
% of genes near scaffold ends (potentially truncated) 1.77 %
% of genes from short scaffolds (< 2000 bps) 6.19 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (93.805 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(23.009 % of family members)
Environment Ontology (ENVO) Unclassified
(37.168 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.363 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 42.19%    β-sheet: 0.00%    Coil/Unstructured: 57.81%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF08450SGL 43.36
PF02866Ldh_1_C 7.96
PF01243Putative_PNPOx 4.42
PF00482T2SSF 2.65
PF00903Glyoxalase 1.77
PF03938OmpH 1.77
PF00072Response_reg 0.88
PF02627CMD 0.88
PF00501AMP-binding 0.88
PF01168Ala_racemase_N 0.88
PF00856SET 0.88
PF01596Methyltransf_3 0.88
PF00351Biopterin_H 0.88
PF07992Pyr_redox_2 0.88
PF01933CofD 0.88
PF01808AICARFT_IMPCHas 0.88
PF03989DNA_gyraseA_C 0.88
PF01261AP_endonuc_2 0.88
PF07676PD40 0.88
PF00037Fer4 0.88
PF13751DDE_Tnp_1_6 0.88
PF01625PMSR 0.88
PF12840HTH_20 0.88
PF08240ADH_N 0.88
PF13442Cytochrome_CBB3 0.88
PF14224DUF4331 0.88
PF00216Bac_DNA_binding 0.88
PF01425Amidase 0.88
PF06262Zincin_1 0.88
PF00056Ldh_1_N 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 43.36
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 43.36
COG0039Malate/lactate dehydrogenaseEnergy production and conversion [C] 8.85
COG2825Periplasmic chaperone for outer membrane proteins, Skp familyCell wall/membrane/envelope biogenesis [M] 1.77
COG0138AICAR transformylase/IMP cyclohydrolase PurHNucleotide transport and metabolism [F] 0.88
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.88
COG0188DNA gyrase/topoisomerase IV, subunit AReplication, recombination and repair [L] 0.88
COG0225Peptide methionine sulfoxide reductase MsrAPosttranslational modification, protein turnover, chaperones [O] 0.88
COG0391Archaeal 2-phospho-L-lactate transferase/Bacterial gluconeogenesis factor, CofD/UPF0052 familyCarbohydrate transport and metabolism [G] 0.88
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.88
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.88
COG1486Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolaseCarbohydrate transport and metabolism [G] 0.88
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.88
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.88
COG3186Phenylalanine-4-hydroxylaseAmino acid transport and metabolism [E] 0.88
COG3824Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domainPosttranslational modification, protein turnover, chaperones [O] 0.88
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.88
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A93.81 %
All OrganismsrootAll Organisms6.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009093|Ga0105240_10047006All Organisms → cellular organisms → Bacteria5463Open in IMG/M
3300010379|Ga0136449_102271273Not Available788Open in IMG/M
3300021170|Ga0210400_11257025All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium595Open in IMG/M
3300021432|Ga0210384_11761275All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia525Open in IMG/M
3300025903|Ga0207680_11071373All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium576Open in IMG/M
3300031231|Ga0170824_119856868All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium521Open in IMG/M
3300031754|Ga0307475_10323815All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300032955|Ga0335076_10375956All Organisms → cellular organisms → Bacteria → Acidobacteria1306Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil23.01%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment11.50%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.08%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.42%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.65%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.65%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.65%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.77%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.77%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.77%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.77%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.89%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.89%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.89%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.89%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.89%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.89%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.89%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.89%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.89%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.89%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.89%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009400Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010346AD_USMOcaEngineeredOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300020057Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027799 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MGEnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028043 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MGEnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
deeps_006497802199352024SoilMTQENIQIGAGVLAVILIVIIILRRKGKKKQQEDEF
INPhiseqgaiiFebDRAFT_10554521823300000364SoilMTQETVQIISGVLAVLLVGIIILRRKSKKKQQEDEF*
Ga0058859_1174558323300004798Host-AssociatedLYCLVVPSRRSMTQETVQIIAGVLAVVLIGLIIMRRKGKKKTQDDEF*
Ga0070734_10000228493300005533Surface SoilMTQQNVVQIVAGILCVLLVAIIIMRRKNKKKSQQDEF*
Ga0070730_1092873013300005537Surface SoilMTQSTVQIVAGVLCLLLIVVVIMRRKGKKKTEDDF*
Ga0066695_1043575923300005553SoilMTQETVQIVAGVLLVVIIGILIMRRKGKKKQQEDEF*
Ga0068859_10209876123300005617Switchgrass RhizosphereGDRSMTQETVQIVAGVLAVLLIGIIIMRRKNKKKTQEDEF*
Ga0068864_10093127713300005618Switchgrass RhizosphereMTQETVQIIAGVLAVLIIGIVIMRRKNKKKTQDDEF*
Ga0066905_10095562123300005713Tropical Forest SoilMTQETVQIVAGVLAVLLIGIVIMRRKSKKKTQEDEF*
Ga0066903_10042120533300005764Tropical Forest SoilMTQQTVQIVAGVLAVILVGIVILRRKNKKSKGADDEF*
Ga0066903_10075604923300005764Tropical Forest SoilMSQETVQIVAGVLAVILIGIIIMRRKGKKKTEDEF*
Ga0066903_10432563323300005764Tropical Forest SoilMTQETVQIVAGVLALVLVAIIILRRKSKKKQQEDEF*
Ga0074470_1072408313300005836Sediment (Intertidal)MTQETVQIIAGVLALLLVGIIILRRKNKKKQQEDEF*
Ga0068863_10218184323300005841Switchgrass RhizosphereFSFPRGDRSMTQETVQIIAGVLAVLIIGIVIMRRKNKKKTQDDEF*
Ga0068860_10129318813300005843Switchgrass RhizosphereLTFHRGDRSMTQETVQIVAGVLAVLIIGIIIMRRKNKKKTQEDEF*
Ga0066656_1022021813300006034SoilMTQETVQIVAGVLLVVVIGILIMRRKNKKKTQEDEF*
Ga0075028_10027980923300006050WatershedsMSSETVQIIAGLLCVVLVGVIIMRRKTKKKTDQQDEF*
Ga0079037_10247777423300006224Freshwater WetlandsLEDLAHVATETIVQIVSGVLAVACVVIIIMRRKKKKKQQEDEF*
Ga0075421_10090622643300006845Populus RhizosphereMTQETVQIVAGVLAVLIIGIIIMRRKNKKKTQEDEF*
Ga0075421_10135232323300006845Populus RhizosphereMTQETVQIVSGALAVLLVGIIFLRRKNKKKQQEDEF*
Ga0075431_10000974143300006847Populus RhizosphereMTQETVQLVAGALAVLLVGIIILRRKNKKKQQEDEF*
Ga0075425_10044739233300006854Populus RhizosphereMTQETVQIVAGVLAVILIAIVILRRKNKKKQQEDEF*
Ga0075424_10110466443300006904Populus RhizosphereMSQTTVQVISGILCVILIVIIILRRKSKKKTEDEF*
Ga0099791_1021806323300007255Vadose Zone SoilMTQETVQIIAGVLAVLLIGIVIMRRKSKKKTQEDEF*
Ga0066710_10023193433300009012Grasslands SoilMSQTTVQVISGILCVILIVIIILRRKSKKKTEDEF
Ga0066710_10032847013300009012Grasslands SoilMTQETVQIVAGVLLVVVIGILIMRRKNKKKTQEDEF
Ga0099829_1081080313300009038Vadose Zone SoilMTQETVQIVAGVLLAVIIGILIMRRKGKKKQQEDEF*
Ga0099830_1123533423300009088Vadose Zone SoilMTQETVQIIAGVLAVLLIGIIIMRRKSKKKTQEDEF*
Ga0099828_1042849023300009089Vadose Zone SoilMTQETVQLIAGALAVLLIGIIILRRKNKKKQQDDEF*
Ga0099827_1097235923300009090Vadose Zone SoilMTQETVQIIAGVLAVLIIGIVVMRRKSKKKTQEDEF*
Ga0105240_1004700623300009093Corn RhizosphereMTQSTVQIVAGILCLAVIAIIIMRRKGKKKSEDEF*
Ga0066709_10093874023300009137Grasslands SoilMTQETVQIISGALAVLLVGIIFLRRKSKKKEQEDEF*
Ga0099792_1045718423300009143Vadose Zone SoilMSSETVQIIAGVLCIVLVGVIIMRRKNKKKTDQQDEF*
Ga0099792_1071657313300009143Vadose Zone SoilDLSMTQETVQIVAGVLLVVIIGILIMRRKGKKKQQKDEF*
Ga0099792_1079161023300009143Vadose Zone SoilMTQETVQIIAGVLAVLIIGIVIMRRKNKKKTQEDEF*
Ga0114129_1140148723300009147Populus RhizosphereMTQETVQIVAGVLAVLLIGIVIMRRKNKKKTQEDEF*
Ga0075423_1155105723300009162Populus RhizosphereMTQETVQLVAGALAVLLVGIIILRRKNKKKHQEDEF*
Ga0116854_103570923300009400SoilMSQTTVQIIAGVLCVLLIVVIIMRRKSKKKVDDDF*
Ga0126312_1089425213300010041Serpentine SoilMTQETVQLVAGVLAVLLVGIIILRRKSKKKQEDEF*
Ga0126310_1056253123300010044Serpentine SoilMTQETVQLVAGALAVLLVGIIILRRKNKKKQQEDDF*
Ga0116239_1058033113300010346Anaerobic Digestor SludgeQQGSDTVVKVVCGVLAVVLIGIVILRRKSKKKQEDEF*
Ga0134128_10000062993300010373Terrestrial SoilMIQAALTPENVKLISGILAVVLVGIIIMRRKGKKKTEDEF*
Ga0136449_10227127313300010379Peatlands SoilRTEIIMTQTTVQIVAGVLCVVLIAIVILRRKSKKKTEDDF*
Ga0136449_10320425713300010379Peatlands SoilMSQETVQIIAAVLAVVIIGVIIMRRKGGKKKQEDEF*
Ga0150983_1243705523300011120Forest SoilMSQETVQIIAAVLAVVLIGIIIMRRKGGKKKQEDEF*
Ga0137391_1093623323300011270Vadose Zone SoilMNQQTVQIIAGVLCVIIIAVIVLRRKGKKKQEDEF*
Ga0137388_1019961823300012189Vadose Zone SoilMTQETVQLIAGALAVLLVGIIILRRKNKKKQQDDEF*
Ga0137383_1104218613300012199Vadose Zone SoilMTQETVQIIAGVLAVLIIGIVIMRRKSKKKTQEDEF*
Ga0137399_1062422323300012203Vadose Zone SoilMVTEENIKIIAAVLAVVLIAIIIMRRKNKKKQQDDEF*
Ga0137376_1161045423300012208Vadose Zone SoilMSQETVQIVAGVLLVVIIGIIIMRRKNKKKTQEDDF*
Ga0137379_1044854933300012209Vadose Zone SoilMTQETVRIISGVLAVLLVGLIVLRRKSKKKQQEDEF*
Ga0137378_1062484123300012210Vadose Zone SoilMTQETFQIIAGVLAVLIIGIVIMRRKSKKKTQEDEF*
Ga0137377_1123098913300012211Vadose Zone SoilMTQETVQIIAGVLAVVLIAIIILRRKSKKKQQEDEF*
Ga0137377_1168378023300012211Vadose Zone SoilMTQETVQIVAGVLLAVIIGILIMRRKSKKKQQEDEF*
Ga0150985_11736206923300012212Avena Fatua RhizosphereMTQETVQIVAGVLLVVIIGILIMRRKSKKKTQEDDF*
Ga0150985_12086549523300012212Avena Fatua RhizosphereMTQETVQIIAGVLAVVLIGLIIMRRKSKKKTQEDEF*
Ga0150985_12151560123300012212Avena Fatua RhizosphereMTQETVQIIAGILAVVLIGLIIMRRKGKKKTQEDEF*
Ga0137372_1070092223300012350Vadose Zone SoilMTQETVQIIAGVLAVLLIGIIVMRRKSKKKTQEDEF*
Ga0137369_1052937913300012355Vadose Zone SoilTRIAQAGEDMSQEMVRIIAGVLAIILVVIIIMRRKARKKTEDEF*
Ga0137360_1041600723300012361Vadose Zone SoilMTQETVQIVAGVLLVVIIGILIMSRKGKKKQQEDEF*
Ga0150984_10226755923300012469Avena Fatua RhizosphereMTQETVQIVAGVLLVVIIGILIMRRKNKKKTQEDDF*
Ga0137373_1103682323300012532Vadose Zone SoilEEDSMTQETVQIIAGVLAVLLIGIIVMRRKSKKKTQEDEF*
Ga0137398_1097628523300012683Vadose Zone SoilMSQETVQIVAGVLLVVIIGILIMRRKNKKKTQEDDF*
Ga0137394_1119903513300012922Vadose Zone SoilRSIAMTQETVQLVAGALAVLLVGIIILRRKNKKKQQQDDEF*
Ga0137359_1164186413300012923Vadose Zone SoilMTQETVQIIAGVLAVLIIGIVILRRNSKKKTQDDEF*
Ga0164299_1136208923300012958SoilMTQETVQIVAGVLAVLIIGIIIMRRKNKKKTQDDEF*
Ga0157380_1198199023300014326Switchgrass RhizosphereMTQETVQIVAGVLAVLLIGIIIMRRKNKKKTQEDEF*
Ga0182024_1036139833300014501PermafrostMSQETVQIIAAVLAVVIIGVIVMRRKGGKKKQEDEF*
Ga0184638_126696323300018052Groundwater SedimentMTEETVKIVAGVLAVLIIGIIIMRRKSKKKTQEDEF
Ga0184615_1046241623300018059Groundwater SedimentVDANTIVQVVSAVLAVLCVVIIIMRRKKKKKQQDEF
Ga0187893_10001184263300019487Microbial Mat On RocksVNQETVQIISAVLAVLCVVIIILRRKGKKKDSQQDEF
Ga0163151_1022062323300020057Freshwater Microbial MatMTPETVQIISAVLCVALVGIIIMRRKSKKKDAPQDDF
Ga0210400_1125702523300021170SoilLAQVTPQNIVQLIAGILCLALIGILIMRRKGKKKHQEDEF
Ga0213881_1006117023300021374Exposed RockMTSQGTVQLIAAILLVVVIAVIIMRRKGRKKQQEDEF
Ga0210384_1176127523300021432SoilPVTPQNIVQLIAGILCLALIGILIMRRKGKKKHQEDEF
Ga0126371_1091528723300021560Tropical Forest SoilMSQETVQIVAGVLAVILIGIIIMRRKGKKKTEDEF
Ga0179589_1019711923300024288Vadose Zone SoilMSSETVQIIAGVLCIVLVGVIIMRRKNKKKTDQQDEF
Ga0209172_1002925553300025310Hot Spring SedimentMTQETVQIVAAILAVLCVVAIVIRRKNKKKTTSQDDF
Ga0207680_1107137323300025903Switchgrass RhizosphereMTQSTVQIVAGILCLAVIAIIIMRRKGKKKSEDEF
Ga0207701_1028812823300025930Corn, Switchgrass And Miscanthus RhizosphereMTQETVQIIAGVLAVLIIGIVIMRRKNKKKTQDDEF
Ga0207704_1063545723300025938Miscanthus RhizosphereMTQETVQIVAGVLAVLIIGIIIMRRKNKKKTQEDEF
Ga0207641_1173413713300026088Switchgrass RhizospherePFSCYTAFSFPRGDRSMTQETVQIIAGVLAVLIIGIVIMRRKNKKKTQDDEF
Ga0209648_1025790933300026551Grasslands SoilMTQENIQIGAGVLAVILILIIILRRKGKKKQQEDEF
(restricted) Ga0233416_1010574823300027799SedimentMTQETVQIVAGILCIVLVVIIILRRKVKKKKQEDEF
Ga0209060_10000449493300027826Surface SoilMTQQNVVQIVAGILCVLLVAIIIMRRKNKKKSQQDEF
Ga0209590_1023098633300027882Vadose Zone SoilMTQETVQLIAGALAVLLIGIIILRRKNKKKQQDDEF
Ga0209382_1134076223300027909Populus RhizosphereMTQETVQIVSGALAVLLVGIIFLRRKNKKKQQEDEF
Ga0209069_1051160223300027915WatershedsDTTVQIVAGVLLVVIIAVIVMRRKGKKSSSSEDEF
(restricted) Ga0233417_1011599613300028043SedimentLDQSTVQIIAGILCVVCVAIIIMRRKAKKKQSQEDDC
Ga0308309_1139124123300028906SoilMSQETVQLVAAILAVVLIGIIIMRRKGSKKKQEDEF
Ga0170824_11985686823300031231Forest SoilMTPQNIVQLVAGILCLALIGILIMRRKGKKKHQEDEF
Ga0302321_10199671923300031726FenMDQTTVQIIAGVLLVVVIGVIIMRRKGKKTTSTEDDF
Ga0315293_1118108923300031746SedimentVAPEIAVQIGCAVLAVLCVVIIIMRRKKKKKQQQEDEF
Ga0307475_1002588823300031754Hardwood Forest SoilLAQVTPQNIVQLVAGILCLALIGILIMRRKAKKKHQEDEF
Ga0307475_1032381523300031754Hardwood Forest SoilMTPQNIVQLIAGILCLALIGILIMRRKGKKKRQEDEF
Ga0315288_1013832113300031772SedimentVAPEIAVQIGCAVLAVLCVVIIIMRRKKKKKKQQEDEF
Ga0315288_1131527923300031772SedimentVDATTVVQLASAVLAVLCIAVIIMRRKKKKKQKQAEDDF
Ga0308174_1002084623300031939SoilMIQAALTPENVKLISGILAVVLVGIIIVRRKGKKKTEDEF
Ga0315294_1100768813300031952SedimentVAPETVVQIGCAVLAVLCVVIIIMRRKKKKKQQREDEF
Ga0315289_1003267663300032046SedimentVAPETAVQIGCAVLAVLCVVIIIMRRKKKKKQQQEDEF
Ga0315277_1006751663300032118SedimentVAPETAVQIGCAVLAVLCVVIIIMRRKKKKKQQEDEF
Ga0315295_1031997023300032156SedimentVAPEIAVQIGCAVLAVLCVVIIIMRRKKKKKQQEDEF
Ga0315268_1238989323300032173SedimentVAPENVVQIACAVLAVLCVVIIIMRRKKKKKKQEDEF
Ga0315276_1098147713300032177SedimentVAPENVVQIACAVLAVLCVVIIIMRRKKKKKQQQEDEF
Ga0315275_1028878523300032401SedimentVAPEIAVQIGCAVLAVLCVVIIIMRRKKKKKQQEDDF
Ga0348332_1220070223300032515Plant LitterNYCMDAGTIQIIAAVLAVVLIGVIIMRRKGGKKKTDDDF
Ga0315273_1000912763300032516SedimentVAPETVVQIGCAVLAVLCVVIIIMRRKKKKKQQEDEF
Ga0335085_1001977113300032770SoilMTQATVQIVSGVLAVLLIVIVILRRKSKKKQEEDEF
Ga0335076_1037595623300032955SoilMTQSTVQIIAGVLCVLVIVAIFLRRKGKKKTEDDF
Ga0335077_1208935523300033158SoilMSQETIQIVSAVLAVVLIGIIIMRRKGKKKTEDEF
Ga0310810_1019167123300033412SoilMTQETVQIIAGVLAVLLIGIIIMRRKSKKKTQEDEF
Ga0316619_1111004623300033414SoilLEDLAHVATETIVQIVSGVLAVACVVIIIMRRKKKKKQQEDEF
Ga0316617_10257540123300033557SoilVATETIVQIVSGVLAVACVVIIIMRRKKKKKQQEDEF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.