Basic Information | |
---|---|
Family ID | F078446 |
Family Type | Metagenome |
Number of Sequences | 116 |
Average Sequence Length | 43 residues |
Representative Sequence | MLTYSTLQDRPREFLAATGLTHDEFARVLPAFAAAYAVLYPPD |
Number of Associated Samples | 82 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 18.97 % |
% of genes near scaffold ends (potentially truncated) | 96.55 % |
% of genes from short scaffolds (< 2000 bps) | 91.38 % |
Associated GOLD sequencing projects | 82 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.655 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.759 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.241 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.25% β-sheet: 0.00% Coil/Unstructured: 57.75% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF13613 | HTH_Tnp_4 | 3.45 |
PF13359 | DDE_Tnp_4 | 2.59 |
PF13551 | HTH_29 | 1.72 |
PF02585 | PIG-L | 0.86 |
PF00929 | RNase_T | 0.86 |
PF08843 | AbiEii | 0.86 |
PF00106 | adh_short | 0.86 |
PF04255 | DUF433 | 0.86 |
PF04984 | Phage_sheath_1 | 0.86 |
PF14226 | DIOX_N | 0.86 |
PF00583 | Acetyltransf_1 | 0.86 |
PF12695 | Abhydrolase_5 | 0.86 |
PF07228 | SpoIIE | 0.86 |
PF13610 | DDE_Tnp_IS240 | 0.86 |
PF14104 | DUF4277 | 0.86 |
PF02163 | Peptidase_M50 | 0.86 |
PF01656 | CbiA | 0.86 |
PF00535 | Glycos_transf_2 | 0.86 |
PF13565 | HTH_32 | 0.86 |
PF01609 | DDE_Tnp_1 | 0.86 |
PF07978 | NIPSNAP | 0.86 |
PF04986 | Y2_Tnp | 0.86 |
PF08309 | LVIVD | 0.86 |
PF08388 | GIIM | 0.86 |
PF08450 | SGL | 0.86 |
PF00211 | Guanylate_cyc | 0.86 |
PF13714 | PEP_mutase | 0.86 |
PF00589 | Phage_integrase | 0.86 |
PF00528 | BPD_transp_1 | 0.86 |
PF10049 | DUF2283 | 0.86 |
PF03328 | HpcH_HpaI | 0.86 |
PF01381 | HTH_3 | 0.86 |
PF13655 | RVT_N | 0.86 |
PF13176 | TPR_7 | 0.86 |
PF04909 | Amidohydro_2 | 0.86 |
PF01261 | AP_endonuc_2 | 0.86 |
PF00296 | Bac_luciferase | 0.86 |
PF03100 | CcmE | 0.86 |
PF01526 | DDE_Tnp_Tn3 | 0.86 |
PF01799 | Fer2_2 | 0.86 |
PF13358 | DDE_3 | 0.86 |
PF01610 | DDE_Tnp_ISL3 | 0.86 |
PF08241 | Methyltransf_11 | 0.86 |
PF01548 | DEDD_Tnp_IS110 | 0.86 |
PF02012 | BNR | 0.86 |
PF00202 | Aminotran_3 | 0.86 |
PF13340 | DUF4096 | 0.86 |
PF00483 | NTP_transferase | 0.86 |
PF02899 | Phage_int_SAM_1 | 0.86 |
PF12867 | DinB_2 | 0.86 |
PF03466 | LysR_substrate | 0.86 |
PF01844 | HNH | 0.86 |
PF13495 | Phage_int_SAM_4 | 0.86 |
PF03061 | 4HBT | 0.86 |
COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
---|---|---|---|
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.86 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.86 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.86 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.86 |
COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.86 |
COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.86 |
COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.86 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.86 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.86 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.86 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.86 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.86 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.86 |
COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.86 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.86 |
COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.86 |
COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.86 |
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.86 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.86 |
COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.86 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.86 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.86 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.66 % |
Unclassified | root | N/A | 10.34 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000363|ICChiseqgaiiFebDRAFT_10829867 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300000443|F12B_12045490 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300000955|JGI1027J12803_106533481 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300004463|Ga0063356_106493731 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 501 | Open in IMG/M |
3300004633|Ga0066395_10387537 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300005184|Ga0066671_10326456 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300005187|Ga0066675_11441280 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium WGA-4C | 504 | Open in IMG/M |
3300005289|Ga0065704_10750493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 542 | Open in IMG/M |
3300005289|Ga0065704_10854002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 508 | Open in IMG/M |
3300005294|Ga0065705_10238780 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300005295|Ga0065707_10027871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 962 | Open in IMG/M |
3300005295|Ga0065707_10627156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 674 | Open in IMG/M |
3300005332|Ga0066388_100948312 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1432 | Open in IMG/M |
3300005332|Ga0066388_101077046 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
3300005332|Ga0066388_103325492 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300005332|Ga0066388_106878883 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300005332|Ga0066388_107342611 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300005332|Ga0066388_107891356 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300005445|Ga0070708_101560376 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300005764|Ga0066903_101828737 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
3300005764|Ga0066903_102354652 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
3300005983|Ga0081540_1084139 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
3300006797|Ga0066659_11328726 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300006844|Ga0075428_100006238 | All Organisms → cellular organisms → Bacteria | 13256 | Open in IMG/M |
3300006844|Ga0075428_101995162 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300006845|Ga0075421_100312418 | All Organisms → cellular organisms → Bacteria | 1908 | Open in IMG/M |
3300006845|Ga0075421_100374175 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
3300006845|Ga0075421_100457448 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
3300006845|Ga0075421_100775321 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300006846|Ga0075430_100035101 | All Organisms → cellular organisms → Bacteria | 4256 | Open in IMG/M |
3300006847|Ga0075431_100312063 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
3300006852|Ga0075433_11875237 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300006880|Ga0075429_100827660 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300009012|Ga0066710_100360249 | Not Available | 2154 | Open in IMG/M |
3300009012|Ga0066710_102215744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 802 | Open in IMG/M |
3300009090|Ga0099827_10007108 | All Organisms → cellular organisms → Bacteria | 6927 | Open in IMG/M |
3300009090|Ga0099827_10055558 | All Organisms → cellular organisms → Bacteria | 2997 | Open in IMG/M |
3300009090|Ga0099827_10456863 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300009090|Ga0099827_10869223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 781 | Open in IMG/M |
3300009090|Ga0099827_10939552 | Not Available | 749 | Open in IMG/M |
3300009090|Ga0099827_11692422 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300009131|Ga0115027_11536769 | Not Available | 547 | Open in IMG/M |
3300009691|Ga0114944_1039580 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
3300009691|Ga0114944_1349193 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300009815|Ga0105070_1104525 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300010043|Ga0126380_10922564 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 728 | Open in IMG/M |
3300010046|Ga0126384_10663114 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 920 | Open in IMG/M |
3300010047|Ga0126382_12453850 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300010047|Ga0126382_12538476 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300010358|Ga0126370_10480537 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1044 | Open in IMG/M |
3300010360|Ga0126372_10742530 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 964 | Open in IMG/M |
3300010360|Ga0126372_11676095 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300010371|Ga0134125_11108309 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300010398|Ga0126383_10231269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1799 | Open in IMG/M |
3300012189|Ga0137388_10527071 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300012189|Ga0137388_10751033 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → unclassified Spirochaetaceae → Spirochaetaceae bacterium | 905 | Open in IMG/M |
3300012189|Ga0137388_11574313 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300012189|Ga0137388_11609558 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300012207|Ga0137381_10933312 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300012211|Ga0137377_10357182 | Not Available | 1398 | Open in IMG/M |
3300012349|Ga0137387_11225454 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300012351|Ga0137386_10158666 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
3300012353|Ga0137367_10666594 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300012360|Ga0137375_10862818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 722 | Open in IMG/M |
3300012361|Ga0137360_10180899 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
3300012362|Ga0137361_10384666 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
3300012362|Ga0137361_11737260 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300012363|Ga0137390_10240990 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1794 | Open in IMG/M |
3300012495|Ga0157323_1042227 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300012499|Ga0157350_1059197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 505 | Open in IMG/M |
3300012918|Ga0137396_10055259 | Not Available | 2734 | Open in IMG/M |
3300012918|Ga0137396_10255457 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
3300012922|Ga0137394_10801876 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300012925|Ga0137419_11212024 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300012925|Ga0137419_11711579 | Not Available | 537 | Open in IMG/M |
3300012948|Ga0126375_10863748 | All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Parachlamydiales → Parachlamydiaceae | 723 | Open in IMG/M |
3300012971|Ga0126369_10142458 | Not Available | 2242 | Open in IMG/M |
3300012971|Ga0126369_10311954 | Not Available | 1579 | Open in IMG/M |
3300012971|Ga0126369_10371184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1460 | Open in IMG/M |
3300012971|Ga0126369_11845307 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300013092|Ga0163199_1072176 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
3300016387|Ga0182040_10388892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1091 | Open in IMG/M |
3300016404|Ga0182037_11540834 | Not Available | 590 | Open in IMG/M |
3300018053|Ga0184626_10086799 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
3300018053|Ga0184626_10297395 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300018056|Ga0184623_10423661 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 581 | Open in IMG/M |
3300018063|Ga0184637_10691548 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 559 | Open in IMG/M |
3300018064|Ga0187773_10622297 | Not Available | 663 | Open in IMG/M |
3300018075|Ga0184632_10097076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1290 | Open in IMG/M |
3300021073|Ga0210378_10215269 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300026325|Ga0209152_10494520 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300026497|Ga0257164_1002371 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
3300027209|Ga0209875_1025895 | Not Available | 698 | Open in IMG/M |
3300027273|Ga0209886_1031098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
3300027384|Ga0209854_1036779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales | 826 | Open in IMG/M |
3300027846|Ga0209180_10131679 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300027846|Ga0209180_10315751 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300027903|Ga0209488_10045794 | All Organisms → cellular organisms → Bacteria | 3217 | Open in IMG/M |
3300027903|Ga0209488_10421110 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300027961|Ga0209853_1013679 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
3300028792|Ga0307504_10156499 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300028809|Ga0247824_10831844 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300028811|Ga0307292_10289769 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300028889|Ga0247827_11215538 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300031226|Ga0307497_10682080 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300031573|Ga0310915_10745787 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300031820|Ga0307473_10853508 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300031833|Ga0310917_10841069 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300031947|Ga0310909_10963914 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300031947|Ga0310909_11552232 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300032002|Ga0307416_100036196 | All Organisms → cellular organisms → Bacteria | 3782 | Open in IMG/M |
3300032041|Ga0318549_10170086 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 974 | Open in IMG/M |
3300032059|Ga0318533_11110421 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 579 | Open in IMG/M |
3300032075|Ga0310890_11202730 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300032205|Ga0307472_100943864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 803 | Open in IMG/M |
3300032397|Ga0315287_10934539 | Not Available | 1013 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.21% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.62% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.17% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.31% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.59% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.59% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.72% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.72% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.86% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.86% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.86% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.86% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.86% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.86% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.86% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.86% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.86% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiFebDRAFT_108298672 | 3300000363 | Soil | MLTYTTFQDRPREFLATTGLTHAEFARLLPAFATAYVALYPPDKTLEG |
F12B_120454902 | 3300000443 | Soil | MLTYITLQDRPREFLAATGLTHAEFVCLLPVFTAA |
JGI1027J12803_1065334812 | 3300000955 | Soil | MLTFATLQDRLREFLAATGLTHDEFARVLPAFAAAYTVLYPPD |
Ga0063356_1064937312 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLTYATLQARSREFLAATGRTHDEFARVLPAFAAAYAVR* |
Ga0066395_103875371 | 3300004633 | Tropical Forest Soil | MLTYTTLPDRPREFLAATGLTHSEFARVLPAFAAAYALRYPPDKTW |
Ga0066671_103264561 | 3300005184 | Soil | MLTYLTLQDRPREFLAATGLTHEEFARVLPAFAAAYAVLYPPDKTWEGK |
Ga0066675_114412802 | 3300005187 | Soil | MLTYTALQDRPREFLAATGLTHAEFARLLPAFATAYALLYPPEQTLEGQP |
Ga0065704_107504932 | 3300005289 | Switchgrass Rhizosphere | MLTYAILQDRPREFLAATGRTHDEFARVLPAFAAAYTVLYPPDKTWA |
Ga0065704_108540021 | 3300005289 | Switchgrass Rhizosphere | MLTYTTLQDRPREFLAATGLTHAEFAHLLPAFATAYALLYPPEKTLEGMPRQR |
Ga0065705_102387801 | 3300005294 | Switchgrass Rhizosphere | MLTYATLPARSREFLAATGLTHDEFARVLPAFAAAYAVRYPPDK |
Ga0065707_100278711 | 3300005295 | Switchgrass Rhizosphere | MLTYSTLQDRPREFLAATSLTHEEFARVLPAFAAAYAVL* |
Ga0065707_106271561 | 3300005295 | Switchgrass Rhizosphere | VLTYATLQDRPREFLPATGLTHDEFARVLPAFAAAYAVLYPPDKTWE |
Ga0066388_1009483121 | 3300005332 | Tropical Forest Soil | MRTYATLQDRSREFLAAAGLTHDELTCMWPALAAAYAMRAPPDQTWEGML |
Ga0066388_1010770461 | 3300005332 | Tropical Forest Soil | MLTYTTLQDRPREFLAATGRTHAEFAHLLPAFATAYALLYPP |
Ga0066388_1033254922 | 3300005332 | Tropical Forest Soil | MLTYATFQDRPREFLAATGLTHDEFARVLPTFAAAYAVLYPPDKTWEGK |
Ga0066388_1068788832 | 3300005332 | Tropical Forest Soil | MLTYTTLKARPREFLAATGLTHEEFLRVLPAFVTAYTACYP |
Ga0066388_1073426111 | 3300005332 | Tropical Forest Soil | VYNDRMLTYTTLHDRPREFLAATGLTHAEFVHLLPAFATAYARLYPPDKTL |
Ga0066388_1078913561 | 3300005332 | Tropical Forest Soil | MLTYTTLQARPREFLAATGLTHDEFLRVLPAFVAAYTACDPLDKTWQGQ |
Ga0070708_1015603761 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTYTTLQDRPREFLAATGLTHAEFVRLLPAFATAYALLYP |
Ga0066903_1018287371 | 3300005764 | Tropical Forest Soil | MLTYATFQDRPREFLAATGLTHDEFARALPAFAAAYAILYPPDKTWEGKAR |
Ga0066903_1023546523 | 3300005764 | Tropical Forest Soil | MLTYTTIQDRPREFLAATGLMHAEFAHLLPAFATAYALLYPPEQTL |
Ga0081540_10841391 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MLTYATRQDRPREFLAATGLTHSEFARVLPAFAAAY |
Ga0066659_113287262 | 3300006797 | Soil | MLTYLTLQDRPREFLAATGLRHDEFARVLPAFAAAYTLLYPPDKTWE |
Ga0075428_1000062381 | 3300006844 | Populus Rhizosphere | MRTYTALQARPREFLAATGLTHEEFVRLLPAFLAAYAALYPSAK |
Ga0075428_1019951622 | 3300006844 | Populus Rhizosphere | MLTYATLQDRPREFLAATGLTHDEFARVLPAFAAAYAILY |
Ga0075421_1003124183 | 3300006845 | Populus Rhizosphere | MLTYSTLQDRPREFLAATGLTHDEFARVLPAFAAAYAILYPPDK |
Ga0075421_1003741751 | 3300006845 | Populus Rhizosphere | MLTYITLQDRPREFLAATGLTHAEFVCLLPAFTAAY |
Ga0075421_1004574483 | 3300006845 | Populus Rhizosphere | MLTYATLQDRPREFLAATGLTHDEFARVLPAFAAAYAIL |
Ga0075421_1007753211 | 3300006845 | Populus Rhizosphere | MLTYSTLQDRPREFLAATGLTHDEFARVLPAFAAAYAILYPPDKTW |
Ga0075430_1000351014 | 3300006846 | Populus Rhizosphere | VSEGAYAPQTRVQDRPREFLAATGLTHAEFVCLLPAFTAAYAAFYPADKTW |
Ga0075431_1003120633 | 3300006847 | Populus Rhizosphere | LTYATLQDRPREFLAATGLTHDEFTRVLPAFAAAYT* |
Ga0075433_118752371 | 3300006852 | Populus Rhizosphere | GMLTYITLQDRPREFLAATGLTHAEFVCLLPAFTAA* |
Ga0075429_1008276602 | 3300006880 | Populus Rhizosphere | MLTYATLQARSREFLAATGLTHDEFARVLPAFAAAYAVRYPPDKT |
Ga0066710_1003602491 | 3300009012 | Grasslands Soil | MLTYATLQDRPREFLAATGLTHDEFAHVLPAFAAAYAVLYPPDKTWEGKVRQR |
Ga0066710_1022157443 | 3300009012 | Grasslands Soil | MLTYLTLQDRPREFLAATGLTHDEFARVLPAFAAAYVLL |
Ga0099827_100071081 | 3300009090 | Vadose Zone Soil | MLTYPTLQDRPREFLAATGLTHDEFARVLPAFAAA |
Ga0099827_100555581 | 3300009090 | Vadose Zone Soil | MLTYSTLQDRPREVLAATGLTHDECARVLPAFAAAS |
Ga0099827_104568633 | 3300009090 | Vadose Zone Soil | MLTYTTLQDRPKEFLAATSLTPAEFARLLPAFAAAYTVL |
Ga0099827_108692231 | 3300009090 | Vadose Zone Soil | MLTYSTLQDRPREVLAATGLTHDECARVLPAFAAASA |
Ga0099827_109395522 | 3300009090 | Vadose Zone Soil | MLTYTTLQKRPREFLAATGLTHTEFARLLPAFATA |
Ga0099827_116924221 | 3300009090 | Vadose Zone Soil | MLTYSTLQDRPREFLAATGLTHDEFARVLPAFAAAYALLYPPAKTWE |
Ga0115027_115367691 | 3300009131 | Wetland | MLTYANLKDHPREFLAATGLTREEFERLLPIYGTSYAQQYPAQLTA |
Ga0114944_10395801 | 3300009691 | Thermal Springs | MLTYLTLQDRPREFLAATGLTHAEFARLLPAFATAYAVLY |
Ga0114944_13491932 | 3300009691 | Thermal Springs | MLTYTILQDRPREFLAATGLTHAAFAHLLPAFATAYA |
Ga0105070_11045252 | 3300009815 | Groundwater Sand | MLTYSTLQDRPREFLAATGRTHDEFARVLPAFAAASAVLYPPDKTW |
Ga0126380_109225641 | 3300010043 | Tropical Forest Soil | MLTYTTLNNRPRDFLAATGLTHEEFLRVLPAFVAAYTVCYPL |
Ga0126384_106631141 | 3300010046 | Tropical Forest Soil | MLTYITLQNRPREFLAATGLTHTEFARLLPAFATAYAALYPSDQT |
Ga0126382_124538502 | 3300010047 | Tropical Forest Soil | VYNYYMLIYTTLIDRPRDFIAATGLTREEFLRVLPAFVAA |
Ga0126382_125384762 | 3300010047 | Tropical Forest Soil | YYMLTYTTLKDRPREFLAATGLTHAEFMQLLPAFAAA* |
Ga0126370_104805371 | 3300010358 | Tropical Forest Soil | MLTYTTLQDRTREFLAATGLTHSEFARVLPAFAAAYALRYPPDKTWEGKAR |
Ga0126372_107425301 | 3300010360 | Tropical Forest Soil | MLTYTALQNRPREFLTVTGLAHAEFVRLLPAFVTAYVALHPSDKT |
Ga0126372_116760952 | 3300010360 | Tropical Forest Soil | MLTYATLQDRPREFLAATGLTHDEFARVLPAFAAAYA |
Ga0134125_111083091 | 3300010371 | Terrestrial Soil | MLTYITLQDRPREFLAATGLTHAEFERLLPAFTAAYAAFYP |
Ga0126383_102312691 | 3300010398 | Tropical Forest Soil | MLTYATLQDRPREFLAATGLTHDEFARVLPTFAAASAV |
Ga0137388_105270712 | 3300012189 | Vadose Zone Soil | MLTYTTLQYRSREFLAATGLTHDEFARLLPAFAAAYAVRYR* |
Ga0137388_107510332 | 3300012189 | Vadose Zone Soil | MLTYSTLQDRPREFLAATGLTHDEFARVLPAFAAASAVLSPPDKT |
Ga0137388_115743132 | 3300012189 | Vadose Zone Soil | SEIVYNFGMLTYITLQDRPREFLAATGLTHAEFVRLLPAFTAAYAAFYPLAKTW* |
Ga0137388_116095581 | 3300012189 | Vadose Zone Soil | MLTYTTLQDRPREFLAATGLTHAEFAHLLPAFATAYALLYPPEKTLEG |
Ga0137381_109333122 | 3300012207 | Vadose Zone Soil | MLTYTTLQDRPREFLAATGLTHAECAHLLPAFATASTLLY |
Ga0137377_103571823 | 3300012211 | Vadose Zone Soil | MLTYTALQDRPREFLAATGLTHAEFARLLPAFATAYALLYPPEQTLEG |
Ga0137387_112254541 | 3300012349 | Vadose Zone Soil | MLTYSTLQDRPREFLAATSLTHEEFARVLPAFAAA |
Ga0137386_101586661 | 3300012351 | Vadose Zone Soil | MLTYTTLKDRPRAFLAATGLTHAEFVLVLPACAAA |
Ga0137367_106665942 | 3300012353 | Vadose Zone Soil | MLTYTTLQDRPREFLAATGLTHAECAHLLPAFATASTLLYPRA |
Ga0137375_108628182 | 3300012360 | Vadose Zone Soil | MLTYTTLQDRPREFLAATGLRPAECAHLLPAFATASTMLYPRAKTLEGTPR |
Ga0137360_101808991 | 3300012361 | Vadose Zone Soil | MLTYATLQDRPREFLAATGLTHEEFARVLPAFAAAYAVRY |
Ga0137361_103846661 | 3300012362 | Vadose Zone Soil | MLTYSTLQDRPREFLAATGLTHEEFARVLPAFAAAYA |
Ga0137361_117372601 | 3300012362 | Vadose Zone Soil | MLTYTALQDRPREFLAATGLTHAEFARLLPAFATAYALLY |
Ga0137390_102409901 | 3300012363 | Vadose Zone Soil | MLTYTALQDRPREFLAATGLTHAEFARLLPAFATAYAL |
Ga0157323_10422271 | 3300012495 | Arabidopsis Rhizosphere | MLPYITLQDRPREFLAATGLTHAEFGRLLPAFTAAY |
Ga0157350_10591971 | 3300012499 | Unplanted Soil | MLTYTALQDRPREFLAATGLTHAEFARLLPAFATAYALLYPPEKTLEGKPRQR |
Ga0137396_100552591 | 3300012918 | Vadose Zone Soil | MLTYTTLQDRPREFLAATGLTHDEFTRLLPAFAAAYAVCYPPDKTWQG |
Ga0137396_102554573 | 3300012918 | Vadose Zone Soil | MLTYTALQDRPREFLAATRLTHAEFARLLPAFATAYALLYPPEQ |
Ga0137394_108018761 | 3300012922 | Vadose Zone Soil | MLTYSTLQDRPREFLAATGLTHDEFARVLPAFAAAS |
Ga0137419_112120242 | 3300012925 | Vadose Zone Soil | MLTYTALQDRPREFLAATGLTHAEFARLLPAFATAYALLYPPE |
Ga0137419_117115792 | 3300012925 | Vadose Zone Soil | MLTYTTLQDRPREFLAATGLTHDEFARLLPAFAAAYAVRYPSDKTWQG |
Ga0126375_108637481 | 3300012948 | Tropical Forest Soil | MLTYATLPDRPREFLAATGLTHSAWARVLPACAAASAVRSPPDK |
Ga0126369_101424582 | 3300012971 | Tropical Forest Soil | MLTYTTLPDRPREFLAATGLTHSEFARVLPAFAAAYALRYPPDKTWEGKAR |
Ga0126369_103119543 | 3300012971 | Tropical Forest Soil | MLTYTTLPDRTREFLAATGLTHSEFARVLPAFAAAYALRYPPDKTWEG |
Ga0126369_103711841 | 3300012971 | Tropical Forest Soil | MLTYATLQDRPREFLAATGLTHDEFARVLPAFAAASAVLYPPDK |
Ga0126369_118453072 | 3300012971 | Tropical Forest Soil | MLTYTTLQDRPREFLAATGLTHTEFAHLLPAFATAYALLYPPEKT |
Ga0163199_10721761 | 3300013092 | Freshwater | MLTYTTLKDNPRQFLAMTNLKLKEFETLLPAFATAYAVTQS |
Ga0182040_103888922 | 3300016387 | Soil | MLTYSTLQDRPREFLAATSLTHEEFARVLPAFAAAY |
Ga0182037_115408341 | 3300016404 | Soil | MLTYTTLQNRPREFLAATGLTHTEFARLLPAFATAYAALYPSDQTLEGKP |
Ga0184626_100867991 | 3300018053 | Groundwater Sediment | MLTYTTLQDRPREFLAATGLTHEEFVRVLPAYAAAYAVLSPPDKT |
Ga0184626_102973951 | 3300018053 | Groundwater Sediment | MLTYATLQDRPREFLAATGLTHEEFVRVLPAYAAAYAVLSPPDKT |
Ga0184623_104236612 | 3300018056 | Groundwater Sediment | MLTYATLQDRPREFLAATGLTHAEFARLLPAFAVLYP |
Ga0184637_106915481 | 3300018063 | Groundwater Sediment | MLTYITLQDRPREFLAATGLTHAEFVRLLPAFATAYALLYPSEKTAEGKP |
Ga0187773_106222972 | 3300018064 | Tropical Peatland | MLTYDSIKDRPRELLAMTGLTHEEFTRLIPAFTDAYADLYPP |
Ga0184632_100970761 | 3300018075 | Groundwater Sediment | MLTYSTLQDRPREFLAATGLTHDEFARVLPAFAAAYAVLYPPD |
Ga0210378_102152691 | 3300021073 | Groundwater Sediment | GIVYNCRMLTYATLKDRPREFLAATGLTHAEFTRLLPAFAAAYAVRYPPDKT |
Ga0209152_104945201 | 3300026325 | Soil | MLTYTALQNRPREFLAATGLTHAEFARLLPAFATAY |
Ga0257164_10023712 | 3300026497 | Soil | MLTYAALKDKAREFLAATGLTPEEFARWLPAVAAAAAAL |
Ga0209875_10258952 | 3300027209 | Groundwater Sand | MLTYTTLQDRPKEFLAATGLTLAEFARLLPAFAVSYTVLY |
Ga0209886_10310983 | 3300027273 | Groundwater Sand | MLTYTTLQNRPREFLAATGLTHAEFARLLPAFATAYAALYSS |
Ga0209854_10367791 | 3300027384 | Groundwater Sand | MLTYSTLQDRPREFLAATSLTHEEFARVLPAFAAAYAVLYPPDK |
Ga0209180_101316793 | 3300027846 | Vadose Zone Soil | MLTYTTLQDRPREFLAATGLTHAEFAHLLPAFATAYAL |
Ga0209180_103157511 | 3300027846 | Vadose Zone Soil | MVHYHRMLTYITLQDRPRALLAATGPTRVECVRLFAAFATACAAL |
Ga0209488_100457944 | 3300027903 | Vadose Zone Soil | MLTYTALQDRPREFLAATGLTHAEFARLLPAFATAY |
Ga0209488_104211101 | 3300027903 | Vadose Zone Soil | MLTYSTLQDRPREFLAATSLTHEEFARVLPAFAAAYAVLYPPDKTWE |
Ga0209853_10136794 | 3300027961 | Groundwater Sand | MLTDTTLQDRPREFLAATGLTHAEFARLLPAFATAYALLYPSE |
Ga0307504_101564991 | 3300028792 | Soil | MLTYATLQDRPREFLAATGLTHEEFARVLPAFAAAYAVRYPPDKTWEG |
Ga0247824_108318441 | 3300028809 | Soil | VYTYYMLTYTTLKDRPREFLAATGLTHDEFMRVLPA |
Ga0307292_102897692 | 3300028811 | Soil | MLTYTTLQDRPREFLAATGLTHAEFVRLLPAFATAYAR |
Ga0247827_112155381 | 3300028889 | Soil | MLTNTTLQNRPREFLAATGLTHIEFARLLPAFATAYAALYPSDQT |
Ga0307497_106820801 | 3300031226 | Soil | MLTYSTLQDRPREFLAATGLTHDEFARVLPAFAAAYV |
Ga0310915_107457872 | 3300031573 | Soil | MLTYTTLQDRPREFLAATGLMHAEFAHLLPAFATAYALLYPPEQT |
Ga0307473_108535081 | 3300031820 | Hardwood Forest Soil | MLIYATLQDRPREFLAATSLTHDEFARVLPAFAAAYAVL |
Ga0310917_108410691 | 3300031833 | Soil | MLTYTTLKDRPREFLAATGLTHDEFLRVLPAFVTAYTTCYPLDKTWQG |
Ga0310909_109639142 | 3300031947 | Soil | MTVLTYTTLQDRPREFLAATGLMHAEFAHLLPAFATAYALLYP |
Ga0310909_115522321 | 3300031947 | Soil | MLTYTTLQARPREFLAATGLMHAEFAHLLPAFATAYALLYP |
Ga0307416_1000361961 | 3300032002 | Rhizosphere | MLTYTTLKDRPREFLAATGLTHDEFMRVLPAFVTAY |
Ga0318549_101700861 | 3300032041 | Soil | MLTYTTLQDRPREFLAATGLMHAEFAHLLPAFATAYALLYPPEQTLEGKP |
Ga0318533_111104212 | 3300032059 | Soil | MLTYTTLQDRPREFLAATGLTHAEFAYLLPAFATAYALRSPPEKT |
Ga0310890_112027302 | 3300032075 | Soil | MLTYSTLQDRPREFLAATSLTHDEFARVLPAFAAAYAVLYPPDKTWEGK |
Ga0307472_1009438641 | 3300032205 | Hardwood Forest Soil | MLTYTTLQDRPRDFLAATGLTQEEFLRVLPAFVAAYTACYPLDKTWHGN |
Ga0315287_109345393 | 3300032397 | Sediment | MLTYEQLKDRPRELLAATGLTSEEFDRLLPAYQAAECKVL |
⦗Top⦘ |