NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064861

Metagenome / Metatranscriptome Family F064861

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064861
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 49 residues
Representative Sequence MKIGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFSITESYGKD
Number of Associated Samples 113
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 46.09 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.41 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(9.375 % of family members)
Environment Ontology (ENVO) Unclassified
(38.281 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.750 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.30%    β-sheet: 23.40%    Coil/Unstructured: 38.30%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF00753Lactamase_B 16.41
PF00296Bac_luciferase 10.16
PF12146Hydrolase_4 7.03
PF13343SBP_bac_6 5.47
PF00903Glyoxalase 5.47
PF01979Amidohydro_1 1.56
PF12695Abhydrolase_5 1.56
PF14470bPH_3 1.56
PF03401TctC 0.78
PF08240ADH_N 0.78
PF00266Aminotran_5 0.78
PF13646HEAT_2 0.78
PF02738MoCoBD_1 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 10.16
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000550|F24TB_10850718All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium518Open in IMG/M
3300003321|soilH1_10098613All Organisms → cellular organisms → Bacteria5733Open in IMG/M
3300003991|Ga0055461_10074810All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300003999|Ga0055469_10002623All Organisms → cellular organisms → Bacteria2843Open in IMG/M
3300004463|Ga0063356_102244383All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300004463|Ga0063356_103054711All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300005169|Ga0066810_10127120All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium590Open in IMG/M
3300005180|Ga0066685_11118815All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005183|Ga0068993_10056262All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300005294|Ga0065705_10019617All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1862Open in IMG/M
3300005294|Ga0065705_10128595All Organisms → cellular organisms → Bacteria2555Open in IMG/M
3300005328|Ga0070676_11441218All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005333|Ga0070677_10559938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales628Open in IMG/M
3300005340|Ga0070689_101167720All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300005467|Ga0070706_101024116All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300005536|Ga0070697_102062318All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300005545|Ga0070695_100336545All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300005586|Ga0066691_10545576All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300005617|Ga0068859_101571793All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300006196|Ga0075422_10258563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales734Open in IMG/M
3300006797|Ga0066659_11842223All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300006806|Ga0079220_10398362All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300006845|Ga0075421_101760444All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300006845|Ga0075421_102401506All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300006847|Ga0075431_100979848All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300006852|Ga0075433_10203397All Organisms → cellular organisms → Bacteria1760Open in IMG/M
3300006871|Ga0075434_100309326All Organisms → cellular organisms → Bacteria1600Open in IMG/M
3300006881|Ga0068865_100182732All Organisms → cellular organisms → Bacteria1616Open in IMG/M
3300009100|Ga0075418_11971839All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria636Open in IMG/M
3300009792|Ga0126374_10310700All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1062Open in IMG/M
3300009801|Ga0105056_1023866All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium766Open in IMG/M
3300010304|Ga0134088_10011965All Organisms → cellular organisms → Bacteria3731Open in IMG/M
3300010366|Ga0126379_12931702All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium571Open in IMG/M
3300010373|Ga0134128_10412884All Organisms → cellular organisms → Bacteria1507Open in IMG/M
3300010373|Ga0134128_10429601All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1474Open in IMG/M
3300010399|Ga0134127_10026858All Organisms → cellular organisms → Bacteria4545Open in IMG/M
3300010400|Ga0134122_12789028All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300010400|Ga0134122_12826604All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300011409|Ga0137323_1047161All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300011434|Ga0137464_1101944All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300011435|Ga0137426_1005034All Organisms → cellular organisms → Bacteria2970Open in IMG/M
3300011435|Ga0137426_1237858All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300011437|Ga0137429_1100252All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium879Open in IMG/M
3300012129|Ga0137345_1017189All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300012179|Ga0137334_1115031All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium608Open in IMG/M
3300012208|Ga0137376_10109723All Organisms → cellular organisms → Bacteria2345Open in IMG/M
3300012208|Ga0137376_10742045All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300012353|Ga0137367_11093630All Organisms → cellular organisms → Bacteria → Proteobacteria539Open in IMG/M
3300012357|Ga0137384_10117454All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2223Open in IMG/M
3300012360|Ga0137375_10758770All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria785Open in IMG/M
3300012494|Ga0157341_1025999All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium607Open in IMG/M
3300012517|Ga0157354_1025727All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300012582|Ga0137358_11082529All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012923|Ga0137359_10934679All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300012930|Ga0137407_11256858All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300013297|Ga0157378_11931727All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300013306|Ga0163162_10574008All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300013308|Ga0157375_11095433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium932Open in IMG/M
3300013308|Ga0157375_11256018All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300014263|Ga0075324_1000117All Organisms → cellular organisms → Bacteria13271Open in IMG/M
3300014270|Ga0075325_1128229All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300014321|Ga0075353_1240687All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300014969|Ga0157376_10241935All Organisms → cellular organisms → Bacteria1681Open in IMG/M
3300015358|Ga0134089_10175357All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300015372|Ga0132256_101620277All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300015374|Ga0132255_101002867All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1252Open in IMG/M
3300015374|Ga0132255_103018122All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300015374|Ga0132255_105499561All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300016357|Ga0182032_10396693All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1115Open in IMG/M
3300016445|Ga0182038_10694670All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium885Open in IMG/M
3300018027|Ga0184605_10202895All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300018054|Ga0184621_10086271All Organisms → cellular organisms → Bacteria → Proteobacteria1097Open in IMG/M
3300018056|Ga0184623_10426478All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300018074|Ga0184640_10323919All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300018076|Ga0184609_10350698All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300018082|Ga0184639_10367887All Organisms → cellular organisms → Bacteria → Proteobacteria747Open in IMG/M
3300018422|Ga0190265_11117135All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300018476|Ga0190274_10356822All Organisms → cellular organisms → Bacteria1394Open in IMG/M
3300018476|Ga0190274_10753989All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300019254|Ga0184641_1054306All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300019356|Ga0173481_10233514All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300019885|Ga0193747_1128122All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300019886|Ga0193727_1092231All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria904Open in IMG/M
3300020060|Ga0193717_1191023All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300020200|Ga0194121_10172588All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300020579|Ga0210407_11352969All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300021081|Ga0210379_10328234All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300021081|Ga0210379_10366490All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300021082|Ga0210380_10033623All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2197Open in IMG/M
3300021184|Ga0196959_10081850All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300021560|Ga0126371_11287591All Organisms → cellular organisms → Bacteria865Open in IMG/M
(restricted) 3300024521|Ga0255056_10328141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium696Open in IMG/M
3300025160|Ga0209109_10110894All Organisms → cellular organisms → Bacteria1408Open in IMG/M
3300025917|Ga0207660_10733220All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300025917|Ga0207660_10924448All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300025920|Ga0207649_11617011All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300025921|Ga0207652_10523507All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1067Open in IMG/M
3300025925|Ga0207650_11197101All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300025927|Ga0207687_11180379All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300025930|Ga0207701_10171544All Organisms → cellular organisms → Bacteria1917Open in IMG/M
3300025931|Ga0207644_11167969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium647Open in IMG/M
3300025936|Ga0207670_11804330All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300025938|Ga0207704_10154830All Organisms → cellular organisms → Bacteria1623Open in IMG/M
3300025972|Ga0207668_10398594All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1163Open in IMG/M
3300026023|Ga0207677_10506792All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1044Open in IMG/M
3300026029|Ga0208002_1001871All Organisms → cellular organisms → Bacteria1960Open in IMG/M
3300026095|Ga0207676_12587562All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300026325|Ga0209152_10301642All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium600Open in IMG/M
3300026335|Ga0209804_1231448All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium725Open in IMG/M
3300027252|Ga0209973_1014937All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300028381|Ga0268264_12315629All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300030006|Ga0299907_10587698All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300030619|Ga0268386_10782835All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300031820|Ga0307473_10377279All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria921Open in IMG/M
3300031824|Ga0307413_10796217All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300031908|Ga0310900_10120487All Organisms → cellular organisms → Bacteria1723Open in IMG/M
3300031962|Ga0307479_10553402All Organisms → cellular organisms → Bacteria1133Open in IMG/M
3300031962|Ga0307479_11328200All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium679Open in IMG/M
3300031965|Ga0326597_11902461All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300032144|Ga0315910_11640765All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300032180|Ga0307471_100164815All Organisms → cellular organisms → Bacteria2158Open in IMG/M
3300032180|Ga0307471_102705092All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium629Open in IMG/M
3300033004|Ga0335084_10306463All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1641Open in IMG/M
3300033412|Ga0310810_10708960All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium933Open in IMG/M
3300033481|Ga0316600_10194213All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300033551|Ga0247830_11220402All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300034354|Ga0364943_0396690All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300034690|Ga0364923_0077359All Organisms → cellular organisms → Bacteria815Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.38%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.25%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.47%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.47%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.69%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.91%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.91%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment3.12%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands3.12%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.12%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.34%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.34%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.34%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.34%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.34%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.34%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.34%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.34%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.56%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.56%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.56%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.56%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.78%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater0.78%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.78%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.78%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.78%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003991Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009801Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011409Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2EnvironmentalOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300012129Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2EnvironmentalOpen in IMG/M
3300012179Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012494Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610Host-AssociatedOpen in IMG/M
3300012517Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014263Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1EnvironmentalOpen in IMG/M
3300014270Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1EnvironmentalOpen in IMG/M
3300014321Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019254Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020200Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50mEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021184Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024521 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026029Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300027252Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M
3300034690Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
F24TB_1085071813300000550SoilMKIGLFTEFSYVGKSERQAYAEILEQIALADQLGYDFFSTTESFGKDEFSSSPF
soilH1_1009861363300003321Sugarcane Root And Bulk SoilMKVGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFSTTESYGKDLFS
Ga0055461_1007481023300003991Natural And Restored WetlandsMKIGLFTEFSYPGKSEHRLYAEVLEQIAVADQLGYDFFSI
Ga0055469_1000262313300003999Natural And Restored WetlandsLKIGLFTEFSYPGKTEQQTYAEVLEQIALADESGYDFFSITESYGKDLFSCSPFPLGLYV
Ga0063356_10224438313300004463Arabidopsis Thaliana RhizosphereMKIGLFTEFSYPGKSEHQTYADVLEQIAVADELGYDFFSITESYGKDLFSCSPFPLGLY
Ga0063356_10305471123300004463Arabidopsis Thaliana RhizosphereMKIGLFTEFSYPGKSEQQTYADVLAQIALADELGYDFFSITESYGK
Ga0066810_1012712013300005169SoilMKIGLFTEFSYPGKSEHQLYAEVLEQIAEADELGYDFFSITESYGKDLFSCSPF
Ga0066685_1111881513300005180SoilMKIGLFTEFSYPGKSEHQTYTEVLEQIAVADELGFDFFSTTESYGKDLFSCSPFPLGL
Ga0068993_1005626213300005183Natural And Restored WetlandsMKIGLFTEFSYPGKSEQQTYADVLEQLAVADALGYDFFSITESYGKDLFSCSPFPLGLYV
Ga0065705_1001961713300005294Switchgrass RhizosphereMKIGLFTEFSYVGKSERQAYAEILEQIALADQLGYDFFSTTESFGKDEFSCSPF
Ga0065705_1012859513300005294Switchgrass RhizosphereMKIGLFTEFSYPGKSEHQTYADVLEQIAVADGLGYDFFSITESYGKDLFSC
Ga0070676_1144121823300005328Miscanthus RhizosphereMKIGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFSLTESYGKDLFSCS
Ga0070677_1055993823300005333Miscanthus RhizosphereMLRPYVRRGILKIGLFTEFSSPGKSEEQTYSEVLEQIALADELGYDFFSTTESYGKD
Ga0070689_10116772013300005340Switchgrass RhizosphereMKIGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFSITESYGKDLFSCSPF
Ga0070706_10102411623300005467Corn, Switchgrass And Miscanthus RhizosphereMKIGLFTEFSYPGKSERQTYAEVLEQIAVADELGYDFFSTTES
Ga0070697_10206231823300005536Corn, Switchgrass And Miscanthus RhizosphereMKIGLFTEFSYPGKSERQIYAEVLEQIALADELGYDFFSTTESFGKDDVSCSP
Ga0070695_10033654523300005545Corn, Switchgrass And Miscanthus RhizosphereMKIGLFTEFSYPNKSEEQTYAEVLEQIALADELGYDFFSTTESYGRDLF
Ga0066691_1054557623300005586SoilMKIGLFTEFSYPGKSERQTYVDVLEQIALADELGYDFFSTTESYG
Ga0068859_10157179313300005617Switchgrass RhizosphereMKVGLFTEFSYPGKTEQQLYAEVLEQISLADELGYDFFSITESYGKDLFSCSPFPLGLY
Ga0075422_1025856323300006196Populus RhizosphereMKIGLFTEFSYPGKSEQQTYAEVLEQIALADALGYDFFSITESYGKDLFSC
Ga0066659_1184222313300006797SoilMKIGLFTEFSYPEKSERQTYVDVLEQIALADELGYDFFSTTESYGKDLFSCSPFP
Ga0079220_1039836213300006806Agricultural SoilLKIGLFTEFSYPGKSEEQTYSEVLEQIALADELGYDF
Ga0075421_10176044423300006845Populus RhizosphereMKIGLFTEFSYPGKSEQQTYADVLEQIAVADELGYDFFSITESYGKDLFSCSPF
Ga0075421_10240150613300006845Populus RhizosphereMKIGLFTEFSYPGKSEQQTYADVSEQIALADALGYDFFSITESYGKDLFSCSPFPL
Ga0075431_10097984813300006847Populus RhizosphereMKIGLFTEFSYPGKSERQTYADVLEQIAVADELGYDFFSITESYGKDLFSCSPFPL
Ga0075433_1020339733300006852Populus RhizosphereLKIGLFTEFSYPGKSQQQTYAEVLEQIALADELGYDFFSTT
Ga0075434_10030932613300006871Populus RhizosphereMKIGLFTEFSYPDKSEQQTYAEVLEQIALADELGYDFFSTTESYGRDLFSCS
Ga0068865_10018273213300006881Miscanthus RhizosphereMLRPYVRRGILKIGLFTEFSYPGKSEQQTYSEVLEQIALADELGYDFFSTTESY
Ga0075418_1197183913300009100Populus RhizosphereMKIGLFTEFSYVGKSERQAYAEVLEQIALADRLGYDFFSTTES
Ga0126374_1031070013300009792Tropical Forest SoilLGLFTEFSYPEKSERQAYAEILEQIVLADRLGYDFF
Ga0105056_102386623300009801Groundwater SandMKIGLFTEFSYVGKSERQAYAEILQQIALADQLGYDFFSTTESFGKDEFSCSPFPLGLYVAAAQ
Ga0134088_1001196553300010304Grasslands SoilMKIGLFTEFSYPGKSERQIYNEVLEQITLADELGYDFFSTTESFGKDVIS
Ga0126379_1293170213300010366Tropical Forest SoilFMKIGLFTEFSYPEKSERQAYAEILEQIVLADSPRL*
Ga0134128_1041288413300010373Terrestrial SoilLIEKMKIGLFTEFSYPDKSEQQTYAEVLEQIALAD
Ga0134128_1042960133300010373Terrestrial SoilLIEKMKIGLFTEFSYPDKSEQQTYAEVLEQIALADEL*
Ga0134127_1002685863300010399Terrestrial SoilLKIGLFTEFSSPGKSEEQTYSEVLEQIALADELGYDFFSTTESYG
Ga0134122_1278902823300010400Terrestrial SoilMKIGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFSITESY
Ga0134122_1282660423300010400Terrestrial SoilMKIGLFTEFSYPGKSEHQTYADVLEQIAVADELGYDFFSITE
Ga0137323_104716113300011409SoilMKIGLFTEFSYPGKSEQQTYADVLAQIAVADELGYDFF
Ga0137464_110194423300011434SoilMKIGLFTEFSYPGKSEHQLYAEVLEQIAVADELGYDFFSITESYGKDLFSCSPF
Ga0137426_100503413300011435SoilMKIGLFTEFSYPGKSEQQTYADVLEQIAAADELGFDF
Ga0137426_123785813300011435SoilMKIGLFTEFSYPGKSEHQLYAEVLEQIAAADELGYDFYSITESFGKDLFSC
Ga0137429_110025223300011437SoilMKMGLFTEFSYPGKSEQQTYADVLEQIAVADELGYDFFSITESY
Ga0137345_101718923300012129SoilMKIGLFTEFSYPGKSEHQLYAEVLEQIAVADELGYDFFSITESFG
Ga0137334_111503123300012179SoilMKIGLFTEFSYPGKSEQQTYADVLEQIAVADELGYDFFSITESYGKDLFSCSPFPLGLY
Ga0137376_1010972343300012208Vadose Zone SoilMKIGLFTEFSYPEKSERQTYVDVLEQIALADELGY
Ga0137376_1074204523300012208Vadose Zone SoilMKLGLFTEFSYPGKSEHQTYAEVLEQIALADELGYDFFSTTESYGKDLF
Ga0137367_1109363013300012353Vadose Zone SoilMKIGLFTEFSYPEKSELQTYSEVLEQIAVADELGFDFFSTTESYGKDLFSCSPFPLGLY
Ga0137384_1011745413300012357Vadose Zone SoilMKIGLFTEFSYPGKSERQAYAEVLEQISLADELGYDFFSTTESFGKDEVSCSPFPLGL
Ga0137375_1075877023300012360Vadose Zone SoilMKIGLFTEFSYVGKSERQAYAEILEQIALAYQLGYDFFST
Ga0157341_102599923300012494Arabidopsis RhizosphereMKIGLFTEFSYPGKSEQQTYAEVLEQIALADALGYDFF
Ga0157354_102572713300012517Unplanted SoilMKIGLFTEFSYPGKSEQQTYAEVLEQIALADELGYDFFSTTES
Ga0137358_1108252913300012582Vadose Zone SoilMKIGLFTEFSYPGKSEPQTYAEVLEQIALADALGYDFFSITESYGKDLFSCSPFPLGL
Ga0137359_1093467923300012923Vadose Zone SoilMKIGLFTEFSYPGKSERQTYAEVLEQIALADELGYDFFSTTESYGK
Ga0137407_1125685823300012930Vadose Zone SoilMKIGLFTEFSYPGKSEQQTYAEVLEQISLADALGYDFFSITESYGKDLF
Ga0157378_1193172723300013297Miscanthus RhizosphereMKIGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFSI
Ga0163162_1057400813300013306Switchgrass RhizosphereLKIGLFTEFSYPGKSEQQTYSEVLEQIALADELGYDFFSTTESYGKDLFSCSPFPL
Ga0157375_1109543323300013308Miscanthus RhizosphereLKIGLFTEFSSPGKSEEQTYSEVLEQIALADELGY
Ga0157375_1125601833300013308Miscanthus RhizosphereMKIGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFS
Ga0075324_100011713300014263Natural And Restored WetlandsMKIGLFTEFSYPGKSEQQTYAEVWQQIALADELGYD
Ga0075325_112822923300014270Natural And Restored WetlandsMKIGLFTEFSYPGKSEQQTYREVFEQISVADELGFDYSSTTESYGKDLFSCSPFPLGLYVAAGQ
Ga0075353_124068723300014321Natural And Restored WetlandsLFHLRDMKIGLFTEFSYPGKSEHQLYAEVLEQIAVADELG
Ga0157376_1024193533300014969Miscanthus RhizosphereLKIGLFTEFSYPGKSEEQTYSEVLEQIALADELGYDFFSTTESYG
Ga0134089_1017535723300015358Grasslands SoilMKIGLFTEFSYPGKSEHQTYAEVLEQIAVADELGYDFFSTTEGY
Ga0132256_10162027713300015372Arabidopsis RhizosphereMKIGLFTEFSYPGKSEHRTYADVLEQIAVADELGYDF
Ga0132255_10100286713300015374Arabidopsis RhizosphereMKIGLFTEFSYPGKSEQQTYVEVLEQIALADELGYDFFSTTESYGRDLFSC
Ga0132255_10301812223300015374Arabidopsis RhizosphereMKIGLFTEFSYPGKSEQQTYAEVLEQISLADALGYDFFSITESYGKDLFSCSPFPLGLYVGAAQQA
Ga0132255_10549956113300015374Arabidopsis RhizosphereMKIGLFTEFSYPGKSEQQTYAEVLEQIALADALGYDFFSITESYGKDLFSCS
Ga0182032_1039669313300016357SoilMLRPAQNGASLKIGLFTEFSYPGKSEQQTYTEVLEQISLADELGYDFFSTTEGYGKD
Ga0182038_1069467023300016445SoilMKIGLFTEFSYPGKSERQTYTEVLEQIALADELGY
Ga0184605_1020289513300018027Groundwater SedimentMKIGLFTEFSYPEKSEQQTYAEVLEQITVADELEFDFFSTTESYGKDLFSCSPFPLGLYVAAA
Ga0184621_1008627113300018054Groundwater SedimentMKIGLFTEFSYPEKSEQQTYAEVLEQIAVADKLGYDFFSTTESYGKDLFSCSPFPLGLY
Ga0184623_1042647813300018056Groundwater SedimentMKIGLFTEFSYPGKSEQQTYADVLAQIAVADELGYDFFSITESYGKD
Ga0184640_1032391923300018074Groundwater SedimentMKIGLFTEFSYPGKSEQQTYREVLEQIAVADELGYDFFSITESYGK
Ga0184609_1035069813300018076Groundwater SedimentMKIGLFTEFSYPGKSEHQTYADVLEQIAVADELGYNFFSITESFGKDLFSCSPFPLGLYVAAAQRA
Ga0184639_1036788713300018082Groundwater SedimentMKIGLFTEFSYPGKSEHQTYADVLEQIAVADELGYDFFSTTESYGKDLFSCSPFPLGLYV
Ga0190265_1111713513300018422SoilMKVGLFTEFSYPGKSEQQTYREVLEQIAVADELGYDFFSITESYGK
Ga0190274_1035682213300018476SoilMKIGLFTEFSYPGKSEQQTYADVLEQIAVADELGYDFFSITESYGKDLFSCSPFP
Ga0190274_1075398923300018476SoilMDDMKIGLFTEFSYPGKSEHQLYAEVLEQIAVADALGYDFFSITE
Ga0184641_105430613300019254Groundwater SedimentMKIGLFTEFSYPGKSEQQTYTEVLEQIAVADALGYDFFSITESYGKDLFSCSPFP
Ga0173481_1023351423300019356SoilMLRPYVRRGILKIGLFTEFSYPGKSEHQLYAEVLEQIAVADELGYDFFSITE
Ga0193747_112812213300019885SoilMKIGLFTEFSYPGKSERQTYAEVLEQIAVADELGYDFFSTTESYGKDSFSCSPFPL
Ga0193727_109223113300019886SoilMKIGLFTEFSYVGKSERQAYAEVLEQIALADRLGYDFFSTTESYGKDEFS
Ga0193717_119102323300020060SoilMKIGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFSITESYGKDLFSC
Ga0194121_1017258813300020200Freshwater LakeMKIGLFTEFSYPGKTEQQLYAEVLEQIALADQLGYDFFSITESFGKDLFSCSP
Ga0210407_1135296913300020579SoilMKIGLFTEFSYPGKSERQTYAEVLEQIAVADSLGYDFFSTTESFGKDEFSCSPFPL
Ga0210379_1032823413300021081Groundwater SedimentMKIGLFTEFSYPGKSEQQTYREVLEQIAVADELGYDFFSITESYGKDLFSCS
Ga0210379_1036649023300021081Groundwater SedimentMKIGLFTEFSYPGKSEQQTYADVLEQIAVADELGYDF
Ga0210380_1003362343300021082Groundwater SedimentMKIGLFTEFSYPAKSEQQTYADVLEQIAVADELGYDFFSITESYGKDLFSCSP
Ga0196959_1008185023300021184SoilMKIGLFTEFSYPGKSERQTYAEVLEQIAAADALGFDFFSTTESYGKDLFSCSPFPLGLY
Ga0126371_1128759113300021560Tropical Forest SoilMKIGLFTEFSYPGKSEQQTYTEVLEQIALADELGYDFFSTTESYGKDLFSCSPF
(restricted) Ga0255056_1032814123300024521SeawaterMKVGLFTEFSYPGKSEQQTYTEVLEQIAVADELGYDFFSTTESYGKDLFSCSPFPLGLYTAAAQTA
Ga0209109_1011089423300025160SoilMKVGLFTEFSYPGKSEEQTYAEVLEQLAVADELGYDFFSITESYGRDLFSCSPFPLGLYVEQEKR
Ga0207660_1073322013300025917Corn RhizosphereLKIGLFTEFSYPGKSEQQTYSEVLEQIALADELGYDFFSTTESYGK
Ga0207660_1092444813300025917Corn RhizosphereMKIGLFTEFSYPGKSEQQTYAEVLEQIALADELGYDFFSTTE
Ga0207649_1161701123300025920Corn RhizosphereMKIGLFTEFSYPDKSEQQTYAEVLEQIALADELGYDFFSTTESYGRDLF
Ga0207652_1052350713300025921Corn RhizosphereMKIGLFTEFSYPDKSERRAYAEVLEQIAVADELGYDFFSTTESYGEDLF
Ga0207650_1119710113300025925Switchgrass RhizosphereMKIGLFTEFSYPDKSEQQTYAEVLEQIALADELGYDFFSTTESYG
Ga0207687_1118037913300025927Miscanthus RhizosphereMLRPYVRRGILKIGLFTEFSYPGKSEQQTYSEVLEQIALADELGYDFFSTTESYGKDLFSCSPFRSISRN
Ga0207701_1017154413300025930Corn, Switchgrass And Miscanthus RhizosphereMKIGLFTEFSYPGKSEQQTYAEVLEQIALADALGYDFFSI
Ga0207644_1116796923300025931Switchgrass RhizosphereMKVGLFTEFSYPGKTEQQLYAEVLEQISLADELGYDFFSITE
Ga0207670_1180433013300025936Switchgrass RhizosphereMKVGLFTEFSYPGKTEQQLYAEVLEQISLADELGYDFFSITESYGKDLF
Ga0207704_1015483013300025938Miscanthus RhizosphereMLRPYVRRGILKIGLFTEFSSPGKSEEQTYREVLEQIALADELGYDFFSTTESYGK
Ga0207668_1039859423300025972Switchgrass RhizosphereMLRPYVRRGILKIGLFTEFSYPGKSEEQTYSEVLEQIALADELGYDFFSTTESYGKDLFSCSPFPLGL
Ga0207677_1050679223300026023Miscanthus RhizosphereLKIGLFTEFSYPGKSEEQTYSEVLEQIALADELGYDFFSTTESYGKDLFSCS
Ga0208002_100187133300026029Natural And Restored WetlandsMKIGLFTEFSYPGKSEQQTYAEVWQQIALADELGYDFFSTT
Ga0207676_1258756223300026095Switchgrass RhizosphereMKIGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFSITESYGKD
Ga0209152_1030164213300026325SoilMKIGLFTEFSYPGKSERQAYAEVLAQISLADELGYDFFSTTESFGKDEVSCSPFPLGLY
Ga0209804_123144813300026335SoilMKIGLFTEFSYPGKSERQAYAEVLAQISLADELGYDFFSTTESFGKDEVSCSPFPLGLYIAAAQRA
Ga0209973_101493713300027252Arabidopsis Thaliana RhizosphereMKIGLFTEFSYPGKSERQTYDEVFEQILLADGLGY
Ga0268264_1231562923300028381Switchgrass RhizosphereMKIGLFTEFSYPAKSEQQTYADVLEQIAVADELGYDFFSITESYGKDLFS
Ga0299907_1058769823300030006SoilMKIGLFTEFSYPGKSEQQTYREVLEQIAVADELGYDF
Ga0268386_1078283523300030619SoilMKIGLFTEFSYPGKSEQQTYAEVLEQIAVADQLGFDFFSITESYGKDEFSCSPFPLGLYV
Ga0307473_1037727913300031820Hardwood Forest SoilMKIGLFTEFSYPGKSERQIYAEVLEQIALADELGYDFFSTTE
Ga0307413_1079621723300031824RhizosphereMKIGLFTEFSYPGKSEHQLYSEVLEQIAVADELGYDFFSITESYGKDLFSCSPFPLGLYVAAAQ
Ga0310900_1012048733300031908SoilMKIGLFTEFSYPGKSEHQLYAEVLEQIAVADELGYDFFSITESYGKDLFS
Ga0307479_1055340223300031962Hardwood Forest SoilMKIGLFTEFSYPGKSERQIYAEVLEQIALADELGYD
Ga0307479_1132820023300031962Hardwood Forest SoilMKIGLFTEFSYPGKFERQIYAEVLEQIALADELDYDFFSTTESFGKDDVSCSPFPLGLYVAAAQR
Ga0326597_1190246123300031965SoilMKIGLFTEFSYPGKSEQQTYREVLEQIAVADGLGYDFFAITESYG
Ga0315910_1164076513300032144SoilMKIGLFTEFSYPGKSEQQTYAEVLEQIALADELGYDF
Ga0307471_10016481513300032180Hardwood Forest SoilMKIGLFTEFSYPGKSERQTYAEVLEQIAVADSLGYDFFST
Ga0307471_10270509223300032180Hardwood Forest SoilMKIGLFTEFSYPGKFERQIYAEVLEQIALADELDYDFFSTTESF
Ga0335084_1030646313300033004SoilMKIGLFTEFSYPGKSEQQTYHDVFEQIYLADQLGYDFFSITESYGKDLFSCSPFPLG
Ga0310810_1070896013300033412SoilLKIGLFTEFSYPGKSEQQTYSEVLEQIALADELGYDFFSTTESYGKDLFSC
Ga0316600_1019421323300033481SoilMKIGLFTEFSYPGKSEHQLYAEVLEQIAVADELGYDFFSITES
Ga0247830_1122040223300033551SoilMKIGLFTEFSYPGKTEQQTYAEVLEQIAVADELSYDFFSVTESYGR
Ga0364943_0396690_396_5333300034354SedimentMKIGLFTEFSYPGKSEQQTYADVLEQIAAADELGFDFFSITESYGK
Ga0364923_0077359_1_1263300034690SedimentMKIGLFTEFSYPGKSEQQTYREVLEQIAVADELGYDFFSITE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.