NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059252

Metagenome / Metatranscriptome Family F059252

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059252
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 44 residues
Representative Sequence FRRVSFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS
Number of Associated Samples 116
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.75 %
% of genes near scaffold ends (potentially truncated) 97.76 %
% of genes from short scaffolds (< 2000 bps) 95.52 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.045 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.164 % of family members)
Environment Ontology (ENVO) Unclassified
(32.090 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.478 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 43.94%    β-sheet: 0.00%    Coil/Unstructured: 56.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF03824NicO 66.42
PF13490zf-HC2 8.21
PF00579tRNA-synt_1b 1.49
PF13795HupE_UreJ_2 1.49
PF07676PD40 1.49
PF04542Sigma70_r2 1.49
PF01479S4 0.75
PF00296Bac_luciferase 0.75
PF10099RskA 0.75
PF04545Sigma70_r4 0.75
PF08281Sigma70_r4_2 0.75
PF02645DegV 0.75
PF00180Iso_dh 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.49
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.49
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 1.49
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 1.49
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 1.49
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 1.49
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.04 %
UnclassifiedrootN/A8.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459014|G1P06HT01A6U8EAll Organisms → cellular organisms → Bacteria698Open in IMG/M
2228664021|ICCgaii200_c1031650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium945Open in IMG/M
3300004157|Ga0062590_102823937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300004480|Ga0062592_100209954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1383Open in IMG/M
3300005335|Ga0070666_10919483All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300005338|Ga0068868_100125606All Organisms → cellular organisms → Bacteria2095Open in IMG/M
3300005355|Ga0070671_100306699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1352Open in IMG/M
3300005356|Ga0070674_100127195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1895Open in IMG/M
3300005439|Ga0070711_100820432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria790Open in IMG/M
3300005445|Ga0070708_101845403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300005455|Ga0070663_101248736All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300005467|Ga0070706_100414891All Organisms → cellular organisms → Bacteria1253Open in IMG/M
3300005471|Ga0070698_100105172All Organisms → cellular organisms → Bacteria2793Open in IMG/M
3300005540|Ga0066697_10653218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300005553|Ga0066695_10637619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria633Open in IMG/M
3300005559|Ga0066700_10491787Not Available857Open in IMG/M
3300005560|Ga0066670_10758346All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005564|Ga0070664_101762078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300005569|Ga0066705_10204683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1237Open in IMG/M
3300005575|Ga0066702_10421680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium816Open in IMG/M
3300005614|Ga0068856_102319424All Organisms → cellular organisms → Bacteria → Terrabacteria group545Open in IMG/M
3300005764|Ga0066903_104132354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium777Open in IMG/M
3300005764|Ga0066903_105714903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300005842|Ga0068858_100542884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1125Open in IMG/M
3300005844|Ga0068862_102231293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300006032|Ga0066696_10451175All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300006046|Ga0066652_100247934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1558Open in IMG/M
3300006173|Ga0070716_101363032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300006175|Ga0070712_100393274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1143Open in IMG/M
3300006175|Ga0070712_101159849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium672Open in IMG/M
3300006358|Ga0068871_100957691All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300006573|Ga0074055_11719597All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300006581|Ga0074048_11799777Not Available862Open in IMG/M
3300006797|Ga0066659_10682803All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300006804|Ga0079221_11664298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300006804|Ga0079221_11718709All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300006806|Ga0079220_10180492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1198Open in IMG/M
3300006847|Ga0075431_101832821All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300006871|Ga0075434_100015904All Organisms → cellular organisms → Bacteria7226Open in IMG/M
3300006954|Ga0079219_12318473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300009177|Ga0105248_13063169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300009792|Ga0126374_11642071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300010044|Ga0126310_11032533Not Available649Open in IMG/M
3300010301|Ga0134070_10059291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1296Open in IMG/M
3300010304|Ga0134088_10369907Not Available697Open in IMG/M
3300010320|Ga0134109_10457524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300010322|Ga0134084_10320327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300010337|Ga0134062_10634592Not Available554Open in IMG/M
3300010366|Ga0126379_13256153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300010371|Ga0134125_12100865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium614Open in IMG/M
3300010396|Ga0134126_10091627Not Available3747Open in IMG/M
3300010396|Ga0134126_10906101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria991Open in IMG/M
3300010400|Ga0134122_11396015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium714Open in IMG/M
3300011107|Ga0151490_1764355All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes706Open in IMG/M
3300011994|Ga0120157_1033153All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300012189|Ga0137388_10976513All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300012189|Ga0137388_11017852All Organisms → cellular organisms → Bacteria → Terrabacteria group764Open in IMG/M
3300012199|Ga0137383_10598398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium807Open in IMG/M
3300012206|Ga0137380_10354249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1309Open in IMG/M
3300012206|Ga0137380_10858844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium781Open in IMG/M
3300012206|Ga0137380_11056992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium693Open in IMG/M
3300012211|Ga0137377_11697157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300012353|Ga0137367_11128304Not Available528Open in IMG/M
3300012354|Ga0137366_11171658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300012356|Ga0137371_10899417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium673Open in IMG/M
3300012359|Ga0137385_11062025Not Available667Open in IMG/M
3300012488|Ga0157343_1013400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium661Open in IMG/M
3300012907|Ga0157283_10165359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium666Open in IMG/M
3300012929|Ga0137404_11557187All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium612Open in IMG/M
3300012972|Ga0134077_10491914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300012972|Ga0134077_10512975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300012984|Ga0164309_10477007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria949Open in IMG/M
3300013307|Ga0157372_11192419All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300013307|Ga0157372_12202165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium633Open in IMG/M
3300015167|Ga0167661_1090863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces544Open in IMG/M
3300017654|Ga0134069_1221905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium650Open in IMG/M
3300017792|Ga0163161_10896625All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300018433|Ga0066667_10148635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1649Open in IMG/M
3300018468|Ga0066662_12739013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300019882|Ga0193713_1165456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium585Open in IMG/M
3300021080|Ga0210382_10452514All Organisms → cellular organisms → Bacteria → Terrabacteria group569Open in IMG/M
3300024254|Ga0247661_1103238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300025885|Ga0207653_10410956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300025907|Ga0207645_10461559All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria858Open in IMG/M
3300025911|Ga0207654_10262425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1162Open in IMG/M
3300025917|Ga0207660_10327611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1224Open in IMG/M
3300025922|Ga0207646_10754188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium868Open in IMG/M
3300025931|Ga0207644_11269303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium619Open in IMG/M
3300025936|Ga0207670_11637571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300025939|Ga0207665_11127344All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria625Open in IMG/M
3300025939|Ga0207665_11230322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium597Open in IMG/M
3300025961|Ga0207712_10201068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1580Open in IMG/M
3300025981|Ga0207640_10809427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium812Open in IMG/M
3300026023|Ga0207677_10763716Not Available863Open in IMG/M
3300026035|Ga0207703_10898370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium848Open in IMG/M
3300026318|Ga0209471_1064678All Organisms → cellular organisms → Bacteria1653Open in IMG/M
3300026538|Ga0209056_10506067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300026542|Ga0209805_1322832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300026550|Ga0209474_10343680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium842Open in IMG/M
3300026550|Ga0209474_10425413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium682Open in IMG/M
3300027775|Ga0209177_10427493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300027821|Ga0209811_10125256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium939Open in IMG/M
3300027821|Ga0209811_10310765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium607Open in IMG/M
3300028379|Ga0268266_10048727All Organisms → cellular organisms → Bacteria3632Open in IMG/M
3300028380|Ga0268265_12173623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300028587|Ga0247828_10947141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300028704|Ga0307321_1020145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1172Open in IMG/M
3300028705|Ga0307276_10035545All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300028705|Ga0307276_10123447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300028707|Ga0307291_1046851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1035Open in IMG/M
3300028707|Ga0307291_1180335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300028711|Ga0307293_10266686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300028711|Ga0307293_10288065All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300028716|Ga0307311_10176794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M
3300028716|Ga0307311_10231406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300028768|Ga0307280_10021559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1858Open in IMG/M
3300028787|Ga0307323_10034431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1764Open in IMG/M
3300028791|Ga0307290_10297268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300028799|Ga0307284_10358859All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300028824|Ga0307310_10226156All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300028828|Ga0307312_10772639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium636Open in IMG/M
3300028828|Ga0307312_11109630All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300028875|Ga0307289_10329363Not Available628Open in IMG/M
3300028876|Ga0307286_10045002All Organisms → cellular organisms → Bacteria1488Open in IMG/M
3300028878|Ga0307278_10200195Not Available891Open in IMG/M
3300028885|Ga0307304_10201026All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300031847|Ga0310907_10150705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1067Open in IMG/M
3300031943|Ga0310885_10578960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300031995|Ga0307409_100599785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1088Open in IMG/M
3300031996|Ga0308176_11908255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium634Open in IMG/M
3300032180|Ga0307471_102219209All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300032180|Ga0307471_104283660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M
3300034817|Ga0373948_0033741All Organisms → cellular organisms → Bacteria1043Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.21%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.73%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.24%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.49%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.49%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.49%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.49%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.49%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.49%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.49%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.49%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.49%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.49%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.49%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.75%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.75%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.75%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.75%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.75%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.75%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.75%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459014Litter degradation PV2EngineeredOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011994Permafrost microbial communities from Nunavut, Canada - A7_65cm_12MEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012488Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610Host-AssociatedOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300015167Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
2PV_002666402170459014Switchgrass, Maize And Mischanthus LitterIAVLARKAFRRLSFEGSLIRLLPAVSALVILAAGVAMTLRALPKVA
ICCgaii200_103165042228664021SoilRASFEGRLLRLLPAASALVILAAGLAMTARALPKVH
Ga0062590_10282393713300004157SoilAVLARRVFKRMSFEGRLIRLLPAASALVILAAGLAMTAHAVPKVS*
Ga0062592_10020995413300004480SoilSAFRRGTFEGPLVRLLPAASALVILAAGLAMTLRAVPKVS*
Ga0070666_1091948313300005335Switchgrass RhizosphereTGIGLAAVLARSAFRRASFDGRLMRLLPAASALVILAAGLAMTLRAVPKVS*
Ga0068868_10012560613300005338Miscanthus RhizosphereGVGLLAVLARSTFRRLSFEGRLMRLLPAASALVILAAGVAMTLRAFPKVA*
Ga0070671_10030669913300005355Switchgrass RhizosphereVGLAAVVARSAFRRASFEGRLVRLLPAASALVILAAGVAMTLRAVPKVS*
Ga0070674_10012719543300005356Miscanthus RhizosphereIGLAAVLARTAFRRVSFDGRLVRLLPAASALVILAAGLAMTLRAVPKVS*
Ga0070711_10082043213300005439Corn, Switchgrass And Miscanthus RhizosphereLVAVFAKQIFKRASFEGRLVRLLPAASALVILAAGLTMTVRALPKVA*
Ga0070708_10184540323300005445Corn, Switchgrass And Miscanthus RhizosphereLVAVYAKQIFKRASFEGRLIRLLPAASALVILAAGLAMTARALPKVH*
Ga0070663_10124873613300005455Corn RhizosphereGIGLAAVLARSAFRRASFDGRLMRLLPAASALVILAAGLAMTLRAVPKVS*
Ga0070706_10041489113300005467Corn, Switchgrass And Miscanthus RhizosphereTFFSRVSFEGPLMRALPTLSALVVIGLGVAMTLRAVPKVV*
Ga0070698_10010517243300005471Corn, Switchgrass And Miscanthus RhizosphereAFARRSFDGLLIRALPAASALVILAAGVAMTAKALPKVH*
Ga0066697_1065321823300005540SoilARSAFRRFSFEGRLVRLLPTVSALVILVAGLLMTVHALPGVS*
Ga0066695_1063761913300005553SoilTGIGLAAVLARSVFRRVNLDGRFIALLPAVSAFVILAAGVVMTIHALPRVA*
Ga0066700_1049178713300005559SoilGFDGPLVRLLPAASALVILATGLAMTVRAVPKVS*
Ga0066670_1075834623300005560SoilKQIFKRASFNGPLVRLLPAASALVILVAGLAMTVRALPKVS*
Ga0070664_10176207813300005564Corn RhizosphereGIGLAAVLARSAFRRASFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS*
Ga0066705_1020468333300005569SoilVAVFAKQIFKRASFEGRFVRLLPAASALVILAAGLAMTVRALPKVS*
Ga0066694_1023124313300005574SoilGLAAVLAKRVFARASFDGRLLRALPALSALVILAAGVAMTARALPKVG*
Ga0066702_1042168013300005575SoilVIARSAFKRLSFGGRLLSVLPAVSALVILAAGIAMTARALPGVS*
Ga0068856_10231942413300005614Corn RhizosphereALSITGVGLLAVLARSTFRRLSFEGRLMRLLPAASALVILAAGVAMTLRAFPKVA*
Ga0066903_10413235413300005764Tropical Forest SoilVSFEGSIIRLLPAASALVVLGLGVAMTVRALPHVI*
Ga0066903_10571490313300005764Tropical Forest SoilAVLAKRVFARVSFEGRLASLLPAASALVILVAGMAMTLRAIPRIGG*
Ga0068858_10054288413300005842Switchgrass RhizosphereLSFEGRALSLLPAASALVILAAGLAMTIHSLPGVR*
Ga0068862_10223129323300005844Switchgrass RhizosphereAAVLARGAFRRVSLEGPLVRLLPAASALVILAAGLAMTVRAVPKVS*
Ga0066696_1045117513300006032SoilGIGLAAVVARSAFRRLSFEGRLLSLLPAVSALVIVAAGIAMTARALPRLS*
Ga0066652_10024793413300006046SoilSITGIGVVAVLARSAFRRVSFDGTLIRLLPAASALVILAAGLAMTFRALPKVA*
Ga0070716_10136303213300006173Corn, Switchgrass And Miscanthus RhizosphereARSAFRRFSFEGRLVRLLPTGSALVILVAGLLMTVHALPGVS*
Ga0070712_10039327413300006175Corn, Switchgrass And Miscanthus RhizosphereAVFAKQIFKRASFEGRLVRLLPAASALVILAAGLMMTARALPKVH*
Ga0070712_10115984913300006175Corn, Switchgrass And Miscanthus RhizosphereASFEGRLVRLLPAASALVILAAGLMMTARALPKVH*
Ga0068871_10095769113300006358Miscanthus RhizosphereVVARSAFRRATFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS*
Ga0074055_1171959713300006573SoilLVAVFAKQIFKRASFEGRLVRLLPAASALVILAAGLAMTVRALPKVS*
Ga0074048_1179977713300006581SoilRRVSFEGPLVRLLPAASALVILAAGLAMTLRAVPKVS*
Ga0066659_1068280313300006797SoilIGLAAVLARGVFRRVGFDGRVVSLLPTASALVIVAAGLLMTFHALPRVG*
Ga0079221_1166429823300006804Agricultural SoilATFEGRLVRLLPAASALVILAAGPAMTLRAVPKVS*
Ga0079221_1171870923300006804Agricultural SoilAGLALSITGIGLIAVLAKHVFRRASFDGRLIRLLTAASALVILAAGLAMTVRALPKVS*
Ga0079220_1018049213300006806Agricultural SoilGIGLAAVLARSAFRRASFDGRLVRLLPAASALVILAAGLAMTLRAVPKVS*
Ga0075431_10183282113300006847Populus RhizosphereMSFEGRLVRLLPAASALVILAAGLAMTAHAVPKVS*
Ga0075434_100015904143300006871Populus RhizosphereAKQVFKRASFEGRLVRLLPAASALVILVAGLAMTVRALPKVS*
Ga0079219_1231847323300006954Agricultural SoilATFRRVSFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS*
Ga0105248_1306316913300009177Switchgrass RhizosphereRASFEGRLVRLLPAASALVILAAGVAMTLRAVPKVS*
Ga0126374_1164207123300009792Tropical Forest SoilRSFDGALVRALPVLSALVILAAGVAMAASALPKVR*
Ga0126310_1103253323300010044Serpentine SoilGCAAVLARSAFRRVSFDGRLVRLLPAASALVILAAGLAMTVHAVPSLS*
Ga0134070_1005929113300010301Grasslands SoilFSRVSFDGAVVRVLPAVSAVVVLALGVAMTLRAVPRVL*
Ga0134088_1036990713300010304Grasslands SoilRRLSFNGRVLSLLPSASALVILAAGLLMTLHALPQVG*
Ga0134109_1045752423300010320Grasslands SoilFRRLSFEGRLIRLLPAVSALVILAAGLAMTLRAVPKVS*
Ga0134084_1032032723300010322Grasslands SoilFRRASFEGRLIRLLPAASALVILAAGLAMTVRALPKVS*
Ga0134062_1063459213300010337Grasslands SoilSAFRRVSFDGTLIRLLPAASALVILAAGLAMTFRALPKVA*
Ga0126379_1325615323300010366Tropical Forest SoilALSITGVGLAAVVARSAFRRASFEGPLVRLLPAASALVILAAGLAMTLRAVPKVS*
Ga0134125_1210086523300010371Terrestrial SoilGAFRRFSFDGRVVSLLPTASALVIVAAGLVMTLHALPEVG*
Ga0134126_1009162713300010396Terrestrial SoilFKRLSFEGRALSLLPAASALVILAAGLAMTIHSLPAVR*
Ga0134126_1090610113300010396Terrestrial SoilLAAVLARSAFRRASFDGRLMRLLPAASALVILAAGLAMTLRAVPKVS*
Ga0134122_1139601513300010400Terrestrial SoilVGLAAVVARSAFRRATFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS*
Ga0151490_176435513300011107SoilRFSFNGRGLSLLPTASALVILAAGLLMTLHALPQVG*
Ga0120157_103315333300011994PermafrostIGLAAVLARGAFRRVSFDGWVVSFLPTASALVILAAGLVMTLHALPKVG*
Ga0137388_1097651323300012189Vadose Zone SoilLARGAFRRVSFDGRLVSLLPTASALVILAAGLLMTVHALPKVG*
Ga0137388_1101785223300012189Vadose Zone SoilIGLLAVTARRTFSRLSFESRFVRLLPAASALVIIGLGLAMTARAIPGIA*
Ga0137383_1059839823300012199Vadose Zone SoilGLALAITGVGLLAVLAKSAFRRANFDGRLMRLLPVASAFVILVAGLAMTVRALPKVG*
Ga0137380_1035424933300012206Vadose Zone SoilRRSFSRLSFENRLLRLLPAASALVIIGLGLAMTARALPGIA*
Ga0137380_1085884413300012206Vadose Zone SoilIFKRASFEGRLVRLLPAASALVILAAGLAMTARALPKVH*
Ga0137380_1105699223300012206Vadose Zone SoilVGFDGRVVSLLPTASALVIVAAGLLMTFHALPRVG*
Ga0137377_1169715723300012211Vadose Zone SoilAVFAKQIFKRASFEGRLVRLLPAASALVILVAGLAMTARALPKVG*
Ga0137367_1112830413300012353Vadose Zone SoilFRRASFEGRLVRLLPAASALVILVAGIAMTARALPKVS*
Ga0137366_1117165813300012354Vadose Zone SoilVGLLAVLAKRAFARVSFDRGLVALLPAASALVILLAGVVMTVRALPKVTL*
Ga0137371_1089941713300012356Vadose Zone SoilIFKRASFEGRLVRLLPAASALVILAAGLAMTVRALPKVS*
Ga0137385_1106202523300012359Vadose Zone SoilVLARSAFRRFSFEGRFVSLLPTVSALVILAAGLLMTVHALPRVS*
Ga0157343_101340023300012488Arabidopsis RhizosphereAFKRMSFEGRLIRLLPAASALVILAAGLAMTAHAVPKVS*
Ga0157283_1016535923300012907SoilAGLALTITAIGCAAVLARGAFRRVSLEGPLVRLLPAASALVILAAGLAMTVRAVPKVS*
Ga0137404_1155718713300012929Vadose Zone SoilAFRRVSFDGRVVSLLPTASALVIVAAGLLMTLHALPRVD*
Ga0134077_1049191413300012972Grasslands SoilLFRRASFEGGLIRLLPAVSALVVLALGLAMTLRALPRVA*
Ga0134077_1051297513300012972Grasslands SoilQIFKRPSFEGPLVRLLPAVSALVILAAGLAMTVRALPKVA*
Ga0164309_1047700713300012984SoilTAFRRVSFDGRLVRLLPAASALVILAAGLAMTLRAVPKVS*
Ga0157372_1119241933300013307Corn RhizosphereASFDGRLMRLLPAASALVILAAGLAMTLRAVPKVS*
Ga0157372_1220216513300013307Corn RhizosphereYAKQIFKRASFEGRLVRMLPAASALVILAAGLAMTMRALPKVS*
Ga0167661_109086333300015167Glacier Forefield SoilVPIGIGLVAIGARRAFSRMSFEGRFVRALPAISALVIFGLGLAMT
Ga0134069_122190523300017654Grasslands SoilVAVYAKQIFKRASFEGRLVRLLPAASALVILAAGLAMTLRALPKVS
Ga0163161_1089662523300017792Switchgrass RhizosphereGCAAVLARGAFRRVSLEGPLVRLLPAASALVILAAGLAMTVRAVPKVS
Ga0066667_1014863513300018433Grasslands SoilGVGLLAVLARSTFRRLSFEGSLMRLLPAASALVILAAGVAMTLRAFPKVT
Ga0066662_1273901313300018468Grasslands SoilARSAFRRLSFEGRLLSLLPAVSALVIVAAGIAMTARALPRLS
Ga0193713_116545623300019882SoilIGLAAVFARGVFKRLSFEGRALSLLPAASALVILAAGLAMTIHSLPAVR
Ga0210382_1045251413300021080Groundwater SedimentLSFDGRLIRLLPAASALVILVAGLAMTVRALPKVS
Ga0247661_110323823300024254SoilTAFRRVSFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS
Ga0207653_1041095613300025885Corn, Switchgrass And Miscanthus RhizosphereVARTTFRRVSFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS
Ga0207645_1046155923300025907Miscanthus RhizosphereMSPIRLHRLLAAVLARGVFKRLSFEGRALSLLPAASALVILAAGLAMTIHSLPGVR
Ga0207654_1026242533300025911Corn RhizosphereIGLAAVLARSAFRRASFDGRLMRLLPAASALVILAAGLAMTLRAVPKVS
Ga0207660_1032761133300025917Corn RhizosphereLAAVLARSAFRRASFDGRLMRLLPAASALVILAAGLAMTLRAVPKVS
Ga0207646_1075418823300025922Corn, Switchgrass And Miscanthus RhizosphereGAFRRLSFEGRFVSLLPAVSALVILAAGLAMTVHSLPKVR
Ga0207644_1126930313300025931Switchgrass RhizosphereGLALSITGVGLAAVVARSAFRRASFEGRLVRLLPAASALVILAAGVAMTLRAVPKVS
Ga0207670_1163757113300025936Switchgrass RhizosphereGLAAVLARTAFRRMSFEGRLVRLLPAVSALVILAAGLAMTVRAVPKVS
Ga0207665_1112734423300025939Corn, Switchgrass And Miscanthus RhizosphereLRTTSPTSSPLALSITAIGLLAVLARRAFRRLSFEGGLLRLLPAASAVVILAAGIVMTVHAVPQLA
Ga0207665_1123032213300025939Corn, Switchgrass And Miscanthus RhizosphereARSAFRRFSFEGRLVRLLPTGSALVILVAGLLMTVHALPGVS
Ga0207712_1020106813300025961Switchgrass RhizosphereFKRASFEGRLVRLLPAASALVILAAGLAMTARALPKVH
Ga0207640_1080942723300025981Corn RhizosphereGLALSITGIGLAAVLARSAFRRASFDGRLMRLLPAASALVILAAGLAMTLRAVPKVS
Ga0207677_1076371623300026023Miscanthus RhizosphereRGAFRRVSLEGPLVRLLPAASALVILAAGLAMTVRAVPKVS
Ga0207703_1089837013300026035Switchgrass RhizosphereVFKRLSFEGRALSLLPAASALVILAAGLAMTIHSLPGVR
Ga0209471_106467833300026318SoilFNRVRFDGRVIGLLPALSALVILVAGLAMTARAVPKLG
Ga0209056_1050606723300026538SoilARGVFRRVGFDGRVVSLLPTASALVIVAAGLLMTFHALPRVG
Ga0209805_132283213300026542SoilGIGLLAVLAKHAFRRGRFDGRLFGLLPAASALVIVVAGIAMTLRAIPKVH
Ga0209474_1034368023300026550SoilGIGLAAVVARSAFRRLSFEGRLLSLLPAVSALVIVAAGIAMTARALPRLS
Ga0209474_1042541313300026550SoilAVLAKHVFRRASFEGRLIRLLPAASALVILAAGLAMTVRALPKVS
Ga0209177_1042749323300027775Agricultural SoilALSITGVGLAAVVARSAFRRATFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS
Ga0209811_1012525623300027821Surface SoilLSFEGRALSLLPAASALVIVAAGLAMTIHSLPGVR
Ga0209811_1031076523300027821Surface SoilLARTAFRRVSFDGRLVRLLPAASALVILAAGLAMTLRAVPKVS
Ga0268266_1004872713300028379Switchgrass RhizosphereVLARGVFKRLSFEGRALSLLPAASALVILAAGLAMTIHSLPAVR
Ga0268265_1217362313300028380Switchgrass RhizosphereLALTITAIGCAAVLARGAFRRVSLEGPLVRLLPAASALVILAAGLAMTVRAVPKVS
Ga0247828_1094714113300028587SoilVLARGAFRRVSFEGPLVRLLPAASALVILAAGLAMTVRAVPKVS
Ga0307321_102014533300028704SoilVAVFAKRLFRRASFEGRLVRLLPAASALVILAAGLAMTVRALPKVS
Ga0307276_1003554513300028705SoilLSFDGRLVSLLPAASALVILAAGAAMTLHALPKVR
Ga0307276_1012344723300028705SoilSSFEGRLVRLLPAASALVILAAGLAMTARALPKVS
Ga0307291_104685133300028707SoilFRRVSFEGRLVRLLPAASALVILAAGLAMTVRAVPKVS
Ga0307291_118033513300028707SoilIGLVAVFAKRLFRRASFEGRLVRLLPAASALVILAAGLAMTVRALPKVS
Ga0307293_1026668623300028711SoilLARGAFRRLSFDGRVVSLLPTASALVILAAGLVMTLHALPKVG
Ga0307293_1028806523300028711SoilIGLLAVLARGAFRRFSFDGRVVSLLPTASALVIVAAGLVMTLHALPEVG
Ga0307311_1017679413300028716SoilAVVLARGAFRRFSFDGRVVSLLPIASALVIVAVGLVMTLHALPKVG
Ga0307311_1023140613300028716SoilFRRVSFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS
Ga0307280_1002155913300028768SoilKRVFKRASFEGRLVRLLPAASALVILAAGLAMTARALPKVH
Ga0307323_1003443143300028787SoilFRRLSFEGPVMRLLPAASALVILAAGLAMTAHAVPKVG
Ga0307290_1029726823300028791SoilRLSFDGPAMRLLPAASALVILAAGLAMTVHAVPKVG
Ga0307284_1035885923300028799SoilFGRIGFDGRLVRLLPAASALVILLAGVAMTARAFPKVG
Ga0307310_1022615623300028824SoilLARSAFRRLSFEGRALSLLPAVSALVILAAGVAMTVHALPQVR
Ga0307312_1077263913300028828SoilRLSFEGRALSLLPAVSALVILAAGVAMTVHALPQVR
Ga0307312_1110963013300028828SoilIGLAVVLARGAFRRFSFDGRAVSLLPTASALVIVAVGLVMTLHALPKVG
Ga0307289_1032936313300028875SoilLSFEGRLMRLLPAASALVILAAGVAMTLRAFPKVT
Ga0307286_1004500213300028876SoilARSAFRRLSFEGRALSLLPAVSALVILAAGVAMTVHALPQVR
Ga0307278_1020019513300028878SoilAKRAFSRLSFQGRVAGLLPAASALVILVAGVAMTLHALPKVS
Ga0307304_1020102623300028885SoilLAAVLARGAFRRVSFDGRVLSLLPTASALVIVAAGVLMTLHALPRVG
Ga0310907_1015070513300031847SoilFRRATFEGRLVRVLPAASALVILAAGLAMTLRAVPKVS
Ga0310885_1057896013300031943SoilVSLEGPLVRLLPAASALVILAAGLAMTVRAVPKVS
Ga0307409_10059978533300031995RhizosphereLARGAFRRVSLEGPLVRLLPAASALVILAAGLAMTVRAVPKVS
Ga0308176_1190825513300031996SoilAVLARTAFRRVSFEGRLVRLLPAASALVILAAGVAMTLRAVPKVS
Ga0307471_10221920913300032180Hardwood Forest SoilFSRVSFEGPLMRALPTVSALVVIGLGVAMTLRAVPKVV
Ga0307471_10428366023300032180Hardwood Forest SoilVAAVLARGAFRRVSFDGRLVSLLPTASALVILVAGLLMTVHALPRVG
Ga0373948_0033741_886_10413300034817Rhizosphere SoilTGVGLAAVVARSAFRRATFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.