Metagenome / Metatranscriptome Family F055284

Basic Information
Family ID	F055284
Family Type	Metagenome / Metatranscriptome
Number of Sequences	139
Average Sequence Length	40 residues
Representative Sequence	FSTYVIGRMMHRVLVENWEAEKAVEEAHKKVAEIYARHQEA
Number of Associated Samples	110
Number of Associated Scaffolds	139

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.72 %
% of genes near scaffold ends (potentially truncated)	93.53 %
% of genes from short scaffolds (< 2000 bps)	93.53 %
Associated GOLD sequencing projects	105
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.56

Most Common Taxonomy
Group	Bacteria (92.086 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.583 % of family members)
Environment Ontology (ENVO)	Unclassified (27.338 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (42.446 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 55.07% β-sheet: 0.00% Coil/Unstructured: 44.93%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 139 Family Scaffolds
PF01547	SBP_bac_1	12.23
PF00378	ECH_1	5.04
PF01494	FAD_binding_3	4.32
PF02182	SAD_SRA	3.60
PF13416	SBP_bac_8	3.60
PF00296	Bac_luciferase	2.16
PF03401	TctC	1.44
PF05598	DUF772	1.44
PF05685	Uma2	1.44
PF07992	Pyr_redox_2	1.44
PF00528	BPD_transp_1	1.44
PF01594	AI-2E_transport	1.44
PF07947	YhhN	1.44
PF00691	OmpA	1.44
PF01799	Fer2_2	1.44
PF02518	HATPase_c	1.44
PF13378	MR_MLE_C	1.44
PF00496	SBP_bac_5	0.72
PF13561	adh_short_C2	0.72
PF08028	Acyl-CoA_dh_2	0.72
PF09992	NAGPA	0.72
PF03703	bPH_2	0.72
PF13592	HTH_33	0.72
PF12680	SnoaL_2	0.72
PF02775	TPP_enzyme_C	0.72
PF00903	Glyoxalase	0.72
PF02900	LigB	0.72
PF00588	SpoU_methylase	0.72
PF09754	PAC2	0.72
PF01740	STAS	0.72
PF03404	Mo-co_dimer	0.72
PF00144	Beta-lactamase	0.72
PF13673	Acetyltransf_10	0.72
PF13450	NAD_binding_8	0.72
PF00753	Lactamase_B	0.72
PF02738	MoCoBD_1	0.72
PF13676	TIR_2	0.72
PF12697	Abhydrolase_6	0.72
PF03400	DDE_Tnp_IS1	0.72
PF14863	Alkyl_sulf_dimr	0.72
PF01989	AcnX_swivel_put	0.72
PF06439	3keto-disac_hyd	0.72
PF02515	CoA_transf_3	0.72
PF07685	GATase_3	0.72

COG ID	Name	Functional Category	% Frequency in 139 Family Scaffolds
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	8.63
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	4.32
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	4.32
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	4.32
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	2.16
COG0628	Predicted PurR-regulated permease PerM	General function prediction only [R]	1.44
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	1.44
COG3714	Uncharacterized membrane protein YhhN	Function unknown [S]	1.44
COG4636	Endonuclease, Uma2 family (restriction endonuclease fold)	General function prediction only [R]	1.44
COG0219	tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain	Translation, ribosomal structure and biogenesis [J]	0.72
COG0565	tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase	Translation, ribosomal structure and biogenesis [J]	0.72
COG0566	tRNA G18 (ribose-2'-O)-methylase SpoU	Translation, ribosomal structure and biogenesis [J]	0.72
COG1662	Transposase and inactivated derivatives, IS1 family	Mobilome: prophages, transposons [X]	0.72
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.72
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.72
COG1786	Mevalonate 5-phosphate dehydratase subunit 2, swiveling domain (modified mevalonate pathway)	Lipid transport and metabolism [I]	0.72
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	0.72
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.72
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.72
COG3402	Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain	Function unknown [S]	0.72
COG3428	Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain	Function unknown [S]	0.72

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	92.09 %
Unclassified	root	N/A	7.91 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	92.09 %
Unclassified	root	N/A	7.91 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	92.09 %
Unclassified	root	N/A	7.91 %

Name	Rank	Taxonomy	Distribution
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	12.23 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	8.63 %
Unclassified	root	N/A	7.91 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.88 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	2.16 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.72 %
Nitrospinae/Tectomicrobia group	clade	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group	0.72 %

Name	Rank	Taxonomy	Distribution
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	12.23 %
Unclassified	root	N/A	7.91 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	1.44 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.44 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.44 %
Candidatus Tectomicrobia	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia	0.72 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.72 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.72 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.72 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.72 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.72 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	12.23 %
Unclassified	root	N/A	7.91 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	1.44 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.44 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.72 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.72 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.72 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.72 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	0.72 %
Gammaproteobacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis	0.72 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.72 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.72 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	11.51 %
Unclassified	root	N/A	7.91 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.44 %
Candidatus Kentron	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron	0.72 %
Isosphaerales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales	0.72 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.72 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.72 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	0.72 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.72 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.72 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.72 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	0.72 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.72 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	11.51 %
Unclassified	root	N/A	7.91 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.44 %
Isosphaeraceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae	0.72 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.72 %
Xenophilus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Xenophilus	0.72 %
unclassified Streptosporangiales	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales	0.72 %
Candidatus Kentron	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron	0.72 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.72 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.72 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.72 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	0.72 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.72 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	11.51 %
Unclassified	root	N/A	7.91 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.44 %
unclassified Xenophilus	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Xenophilus → unclassified Xenophilus	0.72 %
Streptosporangiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium	0.72 %
Tautonia	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Tautonia	0.72 %
Archangiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae	0.72 %
Candidatus Kentron	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron	0.72 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.72 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.72 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.72 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	0.72 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.72 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	11.51 %
Unclassified	root	N/A	7.91 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.44 %
Vitiosangium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Vitiosangium	0.72 %
Tautonia rosea	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Tautonia → Tautonia rosea	0.72 %
Xenophilus sp. L33	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Xenophilus → unclassified Xenophilus → Xenophilus sp. L33	0.72 %
Streptosporangiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium	0.72 %
Candidatus Kentron	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron	0.72 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.72 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.72 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.72 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	0.72 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.72 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	11.51 %
Unclassified	root	N/A	7.91 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.44 %
unclassified Vitiosangium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Vitiosangium → unclassified Vitiosangium	0.72 %
Tautonia rosea	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Tautonia → Tautonia rosea	0.72 %
Xenophilus sp. L33	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Xenophilus → unclassified Xenophilus → Xenophilus sp. L33	0.72 %
Streptosporangiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium	0.72 %
Candidatus Kentron	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron	0.72 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.72 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.72 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.72 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	0.72 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.72 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	11.51 %
Unclassified	root	N/A	7.91 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.44 %
Vitiosangium sp. GDMCC 1.1324	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Vitiosangium → unclassified Vitiosangium → Vitiosangium sp. GDMCC 1.1324	0.72 %
Tautonia rosea	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Tautonia → Tautonia rosea	0.72 %
Xenophilus sp. L33	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Xenophilus → unclassified Xenophilus → Xenophilus sp. L33	0.72 %
Streptosporangiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium	0.72 %
Candidatus Kentron	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron	0.72 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.72 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.72 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.72 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	0.72 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.72 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000443\|F12B_10032727	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	1320	Open in IMG/M
3300001431\|F14TB_100370762	Not Available	784	Open in IMG/M
3300004463\|Ga0063356_103363271	All Organisms → cellular organisms → Bacteria	689	Open in IMG/M
3300005289\|Ga0065704_10630629	All Organisms → cellular organisms → Bacteria	592	Open in IMG/M
3300005332\|Ga0066388_104758303	All Organisms → cellular organisms → Bacteria	691	Open in IMG/M
3300005445\|Ga0070708_100313120	All Organisms → cellular organisms → Bacteria → Proteobacteria	1479	Open in IMG/M
3300005552\|Ga0066701_10056510	All Organisms → cellular organisms → Bacteria	2176	Open in IMG/M
3300005552\|Ga0066701_10411160	All Organisms → cellular organisms → Bacteria	838	Open in IMG/M
3300005555\|Ga0066692_10468941	All Organisms → cellular organisms → Bacteria	802	Open in IMG/M
3300005559\|Ga0066700_10917475	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	581	Open in IMG/M
3300005569\|Ga0066705_10013879	All Organisms → cellular organisms → Bacteria	3949	Open in IMG/M
3300005586\|Ga0066691_10621732	All Organisms → cellular organisms → Bacteria → Proteobacteria	641	Open in IMG/M
3300005598\|Ga0066706_10337728	All Organisms → cellular organisms → Bacteria → Proteobacteria	1192	Open in IMG/M
3300005713\|Ga0066905_100851553	All Organisms → cellular organisms → Bacteria	794	Open in IMG/M
3300005843\|Ga0068860_100131848	All Organisms → cellular organisms → Bacteria → Proteobacteria	2398	Open in IMG/M
3300005937\|Ga0081455_10590787	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	726	Open in IMG/M
3300006574\|Ga0074056_11285216	All Organisms → cellular organisms → Bacteria → Proteobacteria	720	Open in IMG/M
3300006794\|Ga0066658_10375999	All Organisms → cellular organisms → Bacteria	765	Open in IMG/M
3300006797\|Ga0066659_11584628	All Organisms → cellular organisms → Bacteria	550	Open in IMG/M
3300006844\|Ga0075428_100347438	All Organisms → cellular organisms → Bacteria	1592	Open in IMG/M
3300006845\|Ga0075421_100958397	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	972	Open in IMG/M
3300006845\|Ga0075421_101783580	All Organisms → cellular organisms → Bacteria	663	Open in IMG/M
3300006846\|Ga0075430_100516148	All Organisms → cellular organisms → Bacteria	986	Open in IMG/M
3300006847\|Ga0075431_100609143	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1075	Open in IMG/M
3300006853\|Ga0075420_100861708	All Organisms → cellular organisms → Bacteria	780	Open in IMG/M
3300006871\|Ga0075434_100763778	All Organisms → cellular organisms → Bacteria → Acidobacteria	983	Open in IMG/M
3300006880\|Ga0075429_100679543	All Organisms → cellular organisms → Bacteria	902	Open in IMG/M
3300006880\|Ga0075429_101256854	All Organisms → cellular organisms → Bacteria	646	Open in IMG/M
3300006904\|Ga0075424_101842566	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	640	Open in IMG/M
3300007255\|Ga0099791_10667562	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300009012\|Ga0066710_101858078	All Organisms → cellular organisms → Bacteria	905	Open in IMG/M
3300009012\|Ga0066710_102531601	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	741	Open in IMG/M
3300009012\|Ga0066710_103067664	All Organisms → cellular organisms → Bacteria	647	Open in IMG/M
3300009012\|Ga0066710_104249293	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	535	Open in IMG/M
3300009012\|Ga0066710_104858204	Not Available	503	Open in IMG/M
3300009089\|Ga0099828_11705683	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron	554	Open in IMG/M
3300009090\|Ga0099827_10354031	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1249	Open in IMG/M
3300009090\|Ga0099827_10699853	All Organisms → cellular organisms → Bacteria	876	Open in IMG/M
3300009090\|Ga0099827_10767402	All Organisms → cellular organisms → Bacteria	834	Open in IMG/M
3300009090\|Ga0099827_11273030	All Organisms → cellular organisms → Bacteria	640	Open in IMG/M
3300009090\|Ga0099827_11597769	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	568	Open in IMG/M
3300009094\|Ga0111539_10487483	Not Available	1436	Open in IMG/M
3300009100\|Ga0075418_11972014	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M
3300009100\|Ga0075418_12467920	All Organisms → cellular organisms → Bacteria	567	Open in IMG/M
3300009137\|Ga0066709_101548377	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	953	Open in IMG/M
3300009137\|Ga0066709_102174715	All Organisms → cellular organisms → Bacteria	765	Open in IMG/M
3300009147\|Ga0114129_11886265	All Organisms → cellular organisms → Bacteria	725	Open in IMG/M
3300009162\|Ga0075423_11600902	All Organisms → cellular organisms → Bacteria → Proteobacteria	700	Open in IMG/M
3300009444\|Ga0114945_10033129	All Organisms → cellular organisms → Bacteria → Proteobacteria	2782	Open in IMG/M
3300009553\|Ga0105249_10956106	Not Available	925	Open in IMG/M
3300009691\|Ga0114944_1010132	All Organisms → cellular organisms → Bacteria	3099	Open in IMG/M
3300009691\|Ga0114944_1063535	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1369	Open in IMG/M
3300009792\|Ga0126374_10356012	All Organisms → cellular organisms → Bacteria	1006	Open in IMG/M
3300009792\|Ga0126374_10577280	All Organisms → cellular organisms → Bacteria	825	Open in IMG/M
3300009795\|Ga0105059_1028448	Not Available	654	Open in IMG/M
3300009807\|Ga0105061_1080732	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	543	Open in IMG/M
3300010043\|Ga0126380_11924468	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300010047\|Ga0126382_10132219	All Organisms → cellular organisms → Bacteria	1677	Open in IMG/M
3300010047\|Ga0126382_10314532	All Organisms → cellular organisms → Bacteria	1182	Open in IMG/M
3300010047\|Ga0126382_10994693	All Organisms → cellular organisms → Bacteria	734	Open in IMG/M
3300010047\|Ga0126382_11185536	All Organisms → cellular organisms → Bacteria	683	Open in IMG/M
3300010047\|Ga0126382_12215790	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300010114\|Ga0127460_1054222	All Organisms → cellular organisms → Bacteria	1123	Open in IMG/M
3300010166\|Ga0126306_11385756	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300010359\|Ga0126376_12958324	Not Available	525	Open in IMG/M
3300010362\|Ga0126377_11871277	All Organisms → cellular organisms → Bacteria	676	Open in IMG/M
3300010362\|Ga0126377_12722489	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300010362\|Ga0126377_13459464	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300010391\|Ga0136847_11942537	All Organisms → cellular organisms → Bacteria	1454	Open in IMG/M
3300010398\|Ga0126383_11439370	All Organisms → cellular organisms → Bacteria	779	Open in IMG/M
3300010399\|Ga0134127_10568367	All Organisms → cellular organisms → Bacteria	1157	Open in IMG/M
3300011270\|Ga0137391_10195826	All Organisms → cellular organisms → Bacteria	1759	Open in IMG/M
3300011271\|Ga0137393_10815801	All Organisms → cellular organisms → Bacteria	797	Open in IMG/M
3300012199\|Ga0137383_10145675	All Organisms → cellular organisms → Bacteria → Proteobacteria	1733	Open in IMG/M
3300012205\|Ga0137362_11423790	All Organisms → cellular organisms → Bacteria	579	Open in IMG/M
3300012209\|Ga0137379_11275721	All Organisms → cellular organisms → Bacteria	641	Open in IMG/M
3300012210\|Ga0137378_10140437	All Organisms → cellular organisms → Bacteria	2235	Open in IMG/M
3300012211\|Ga0137377_11322462	All Organisms → cellular organisms → Bacteria	651	Open in IMG/M
3300012349\|Ga0137387_10907946	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Tautonia → Tautonia rosea	636	Open in IMG/M
3300012349\|Ga0137387_11297590	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300012351\|Ga0137386_10632927	All Organisms → cellular organisms → Bacteria	770	Open in IMG/M
3300012353\|Ga0137367_10750173	All Organisms → cellular organisms → Bacteria	678	Open in IMG/M
3300012355\|Ga0137369_10217877	All Organisms → cellular organisms → Bacteria	1464	Open in IMG/M
3300012363\|Ga0137390_11611804	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	586	Open in IMG/M
3300012392\|Ga0134043_1291387	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	540	Open in IMG/M
3300012532\|Ga0137373_10274006	All Organisms → cellular organisms → Bacteria	1352	Open in IMG/M
3300012685\|Ga0137397_10696882	All Organisms → cellular organisms → Bacteria	755	Open in IMG/M
3300012917\|Ga0137395_10183042	All Organisms → cellular organisms → Bacteria	1451	Open in IMG/M
3300012918\|Ga0137396_11071953	All Organisms → cellular organisms → Bacteria	578	Open in IMG/M
3300012922\|Ga0137394_10724466	Not Available	836	Open in IMG/M
3300012922\|Ga0137394_11251875	All Organisms → cellular organisms → Bacteria	605	Open in IMG/M
3300012929\|Ga0137404_11072248	All Organisms → cellular organisms → Bacteria	738	Open in IMG/M
3300012944\|Ga0137410_11216126	All Organisms → cellular organisms → Bacteria	649	Open in IMG/M
3300012948\|Ga0126375_11744361	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300012971\|Ga0126369_12567237	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	594	Open in IMG/M
3300013306\|Ga0163162_10573516	All Organisms → cellular organisms → Bacteria	1256	Open in IMG/M
3300014154\|Ga0134075_10016124	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2931	Open in IMG/M
3300015053\|Ga0137405_1358787	All Organisms → cellular organisms → Bacteria	3039	Open in IMG/M
3300015248\|Ga0180079_1026002	All Organisms → cellular organisms → Bacteria	763	Open in IMG/M
3300016445\|Ga0182038_11385121	All Organisms → cellular organisms → Bacteria	630	Open in IMG/M
3300017792\|Ga0163161_11284660	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium	636	Open in IMG/M
3300018078\|Ga0184612_10409589	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	680	Open in IMG/M
3300018433\|Ga0066667_10316915	All Organisms → cellular organisms → Bacteria	1222	Open in IMG/M
3300018466\|Ga0190268_11559395	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Xenophilus → unclassified Xenophilus → Xenophilus sp. L33	578	Open in IMG/M
3300019233\|Ga0184645_1002632	All Organisms → cellular organisms → Bacteria	743	Open in IMG/M
3300019248\|Ga0180117_1403992	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300019259\|Ga0184646_1182014	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300020197\|Ga0194128_10155368	All Organisms → cellular organisms → Bacteria	1296	Open in IMG/M
3300025149\|Ga0209827_11082166	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1859	Open in IMG/M
3300025910\|Ga0207684_10345954	Not Available	1280	Open in IMG/M
3300025922\|Ga0207646_10253667	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1589	Open in IMG/M
3300025922\|Ga0207646_10264419	All Organisms → cellular organisms → Bacteria	1555	Open in IMG/M
3300026524\|Ga0209690_1246516	All Organisms → cellular organisms → Bacteria	561	Open in IMG/M
3300026535\|Ga0256867_10246717	All Organisms → cellular organisms → Bacteria	643	Open in IMG/M
3300027675\|Ga0209077_1165741	All Organisms → cellular organisms → Bacteria	617	Open in IMG/M
3300027873\|Ga0209814_10150128	All Organisms → cellular organisms → Bacteria	1000	Open in IMG/M
3300027874\|Ga0209465_10098513	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Vitiosangium → unclassified Vitiosangium → Vitiosangium sp. GDMCC 1.1324	1433	Open in IMG/M
3300027882\|Ga0209590_10405831	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	880	Open in IMG/M
3300027909\|Ga0209382_10571688	All Organisms → cellular organisms → Bacteria	1235	Open in IMG/M
3300027957\|Ga0209857_1060142	Not Available	659	Open in IMG/M
3300027961\|Ga0209853_1025838	All Organisms → cellular organisms → Bacteria	1749	Open in IMG/M
3300028673\|Ga0257175_1015641	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1209	Open in IMG/M
3300030006\|Ga0299907_11037224	All Organisms → cellular organisms → Bacteria	600	Open in IMG/M
3300030006\|Ga0299907_11268895	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300030574\|Ga0247648_1089998	All Organisms → cellular organisms → Bacteria	669	Open in IMG/M
3300030608\|Ga0247651_10054388	All Organisms → cellular organisms → Bacteria	876	Open in IMG/M
3300030830\|Ga0308205_1048054	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300030902\|Ga0308202_1098894	All Organisms → cellular organisms → Bacteria	600	Open in IMG/M
3300031092\|Ga0308204_10006111	All Organisms → cellular organisms → Bacteria	1954	Open in IMG/M
3300031092\|Ga0308204_10183664	All Organisms → cellular organisms → Bacteria	642	Open in IMG/M
3300031572\|Ga0318515_10710200	All Organisms → cellular organisms → Bacteria	532	Open in IMG/M
3300031908\|Ga0310900_10288235	All Organisms → cellular organisms → Bacteria	1201	Open in IMG/M
3300031908\|Ga0310900_10990205	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	691	Open in IMG/M
3300032180\|Ga0307471_100356139	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1576	Open in IMG/M
3300032180\|Ga0307471_102286778	All Organisms → cellular organisms → Bacteria	682	Open in IMG/M
3300032205\|Ga0307472_102408782	Not Available	534	Open in IMG/M
3300034659\|Ga0314780_178834	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300034676\|Ga0314801_178557	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	82.73%
Host-Associated	Host-Associated	17.27%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	74.10%
Plants	Host-Associated → Plants	17.27%
Aquatic	Environmental → Aquatic	8.63%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	74.10%
Rhizosphere	Host-Associated → Plants → Rhizosphere	12.95%
Freshwater	Environmental → Aquatic → Freshwater	4.32%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.32%
Thermal Springs	Environmental → Aquatic → Thermal Springs	2.88%
Sediment	Environmental → Aquatic → Sediment	1.44%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	64.75%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	12.95%
Loam	Environmental → Terrestrial → Soil → Loam	6.47%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.60%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.88%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	2.88%
Sand	Environmental → Terrestrial → Soil → Sand	2.88%
Lake	Environmental → Aquatic → Freshwater → Lake	1.44%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.44%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.72%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	43.17%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	12.95%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	12.95%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	5.76%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.60%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.88%
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	2.88%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.88%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.88%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	2.88%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.16%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.44%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.44%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.72%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.72%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.72%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	21.58%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	12.23%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	10.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.19%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.47%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	5.76%
Thermal Springs	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs	2.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.88%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.88%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	2.88%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	2.16%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.16%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.16%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.16%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.44%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.44%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.72%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.72%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.72%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.72%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.72%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.72%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.72%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.72%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.72%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000443	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006574	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009444	Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3	Environmental	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009691	Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009795	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50	Environmental	Open in IMG/M
3300009807	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010114	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012392	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014154	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015	Environmental	Open in IMG/M
3300015053	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015248	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT530_16_10D	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300019233	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019248	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019259	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020197	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m	Environmental	Open in IMG/M
3300025149	Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026524	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)	Environmental	Open in IMG/M
3300026535	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)	Environmental	Open in IMG/M
3300027675	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027957	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes)	Environmental	Open in IMG/M
3300027961	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)	Environmental	Open in IMG/M
3300028673	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B	Environmental	Open in IMG/M
3300030006	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67	Environmental	Open in IMG/M
3300030574	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030608	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030830	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030902	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031092	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031572	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300034659	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034676	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.56
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.56
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F055284

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F12B_100327272	3300000443	Soil	EVLATYVIGRMMHRVLVENWNVEKAVVEAHKKAQDIYARYQGA*
F14TB_1003707621	3300001431	Soil	IGRMMHRVLVESWNVEKAVEEAHKKVAEIYARHQA*
Ga0063356_1033632712	3300004463	Arabidopsis Thaliana Rhizosphere	GEVYATTVLARMVHRVVVDNWEAEKAVKEAHNKIVEIYARWPEG*
Ga0065704_106306291	3300005289	Switchgrass Rhizosphere	LATYTIGRMMHRVLVESWNVEKAVVEAHKKAQDIYNRYQGA*
Ga0066388_1047583031	3300005332	Tropical Forest Soil	EVSSTYVIGRMMHRVLVDYWAAEKAVEEAHKKAVEIYARYQEG*
Ga0070708_1003131201	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	EVLATFTIGRMMHRVLVESWNVEKAVAEAHKKVAEIYARHQRG*
Ga0066701_100565105	3300005552	Soil	GEVLATFVIGRMMHRVLVESWNVEKAVVEAHQKVVEIYKRHQAG*
Ga0066701_104111601	3300005552	Soil	ARMMHRVLVEHWEVEKAVEETHKQVAEIYARHAAG*
Ga0066692_104689413	3300005555	Soil	ASGEVLATFVIGRMMHRVLVESWNVEKAVVEAHQKVVEIYKRHQAG*
Ga0066700_109174751	3300005559	Soil	IGRMMHRVLVENWEAEKAVEEAHKKAVEIYARYQEA*
Ga0066705_100138795	3300005569	Soil	RMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA*
Ga0066691_106217322	3300005586	Soil	RMMHRVLVESWNVEKAVVEAHKKVAEIYKRHQAG*
Ga0066706_103377283	3300005598	Soil	ATFVIGRMMHRVLVESWNVEKAVVEAHKKVAEIYKRHQAG*
Ga0066905_1008515533	3300005713	Tropical Forest Soil	GEVSSTYVIGRMMHRVLVDYWAAEKAVEEAHKKAVEIYARYQEG*
Ga0068860_1001318483	3300005843	Switchgrass Rhizosphere	VIGRMMHRVLVESWNVEKAVEEAHKKVAEIYARHQA*
Ga0081455_105907872	3300005937	Tabebuia Heterophylla Rhizosphere	RMIQRVLVESWEAEKAVEEAHKKVVEIYARYPEG*
Ga0074056_112852161	3300006574	Soil	AASGEVLATFVIGRMMHRVLVESWNVEKAVEEAHKKVAEIYARHQT*
Ga0066658_103759992	3300006794	Soil	VGEVSSTYMIGRMMHRVLVENWEAEKAVEEAHKKVVEIYARHQEA*
Ga0066659_115846281	3300006797	Soil	STYLIGRMMHRVLVENWEAEKAVEEAHKKVVEIYARHQEA*
Ga0075428_1003474384	3300006844	Populus Rhizosphere	TIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA*
Ga0075421_1009583971	3300006845	Populus Rhizosphere	VLATFTIGRMMHRVLVESWTAEKAVEEAHKKVAEIYARHHQGRA*
Ga0075421_1017835803	3300006845	Populus Rhizosphere	LATYTIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA*
Ga0075430_1005161482	3300006846	Populus Rhizosphere	ATYTISRMLHRVLAENWEAERAVKEAHKKVVEIYARHQEG*
Ga0075431_1006091432	3300006847	Populus Rhizosphere	IGRMMHRVLVENWEAEKAVEEAHKKIVEIYARHQEA*
Ga0075420_1008617082	3300006853	Populus Rhizosphere	AAGEVIATNVLARMMHRVLVEEWEAEKAVEEAHKKIVEIYTRAAQG*
Ga0075434_1007637782	3300006871	Populus Rhizosphere	AAGEVLATYVIGRMMHRVLVESWNIEKAVVEAHKKVQDIYARYQGA*
Ga0075429_1006795431	3300006880	Populus Rhizosphere	RMMHRVLVDNWEAEKAVEEAHNKVVEIYARYPEG*
Ga0075429_1012568541	3300006880	Populus Rhizosphere	TSVLARMMHHVLVDGWEAEKAVEEAHKKVVEIYARYPEG*
Ga0075424_1018425661	3300006904	Populus Rhizosphere	RMMHRVLVESWNVEKAVVEAHKKAQDIYNRYQGA*
Ga0099791_106675622	3300007255	Vadose Zone Soil	ATFVIGRMMHRVLVESWNAEKAVGEAHKKVAEIYKRHQAG*
Ga0066710_1018580781	3300009012	Grasslands Soil	STYLIGRMMHRVLVENWEAEKAVEEAHKKVAEIYARHQET
Ga0066710_1025316011	3300009012	Grasslands Soil	YTIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA
Ga0066710_1030676642	3300009012	Grasslands Soil	ATFTIGRMMHRVLVESWAVEKAVAEAHKKVAEIYARHQKA
Ga0066710_1042492931	3300009012	Grasslands Soil	TYTIGRMMHRVLVENWNVEKAVVEAHKKVAEIYARYQGA
Ga0066710_1048582042	3300009012	Grasslands Soil	GEVLATFTIGRMMHRVLVESWNVEKAVEEAHKKVAEIYARHQKG
Ga0099828_117056832	3300009089	Vadose Zone Soil	MMHRALVENLEAEKAVEEAHKKVVEIYAHNQGES*
Ga0099827_103540312	3300009090	Vadose Zone Soil	MMHRALVENLEAEKAVEEAHKKVVEIYAHNQEES*
Ga0099827_106998531	3300009090	Vadose Zone Soil	TTYVIARMMHRVLVEHWEVEKAVEETHKQVAEIYARHAAG*
Ga0099827_107674022	3300009090	Vadose Zone Soil	TIGRMMHRVLVENWNVEKAVVEAHKKVAEIYARHQKE*
Ga0099827_112730302	3300009090	Vadose Zone Soil	ASGEVLATYTIGHMLHRVLVESWEVEKAVEETHKKVAEIYARHQEG*
Ga0099827_115977692	3300009090	Vadose Zone Soil	GRMMHRVLVENWEAEKAVEEAHKKTVEIYARHQEG*
Ga0111539_104874831	3300009094	Populus Rhizosphere	VLGHMIQRVLVEGWEAEKAVEEAHTKVAAIYARHQEA*
Ga0075418_119720142	3300009100	Populus Rhizosphere	LARMMHHVLVDNWEPEKAVEEAHNKVVEIYARYPEG*
Ga0075418_124679201	3300009100	Populus Rhizosphere	RMVHRVLVDHWEAEKAVEDAHRQAVEIYARYPEG*
Ga0066709_1015483772	3300009137	Grasslands Soil	YTIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA*
Ga0066709_1021747152	3300009137	Grasslands Soil	VLATFVIGRMMHRVLVESWNAEKAVEEAHKKVATIYARHQAA*
Ga0114129_118862651	3300009147	Populus Rhizosphere	IGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA*
Ga0075423_116009021	3300009162	Populus Rhizosphere	EVLATFTIGRMMHRVLVENWPVEKSVEEAHKKVAEIYARHNKG*
Ga0114945_100331296	3300009444	Thermal Springs	EVLGTYVIGRMMHRVLVESWAAENAVEEAHKKVVEIYARHQEA*
Ga0105249_109561062	3300009553	Switchgrass Rhizosphere	GHMIQRVLVEGWEAEKAVAEAHTKVAAIYARHQDA*
Ga0114944_10101323	3300009691	Thermal Springs	MMHRVLVENWEAEKAVEEAHKKVAEIYARHQQES*
Ga0114944_10635352	3300009691	Thermal Springs	VFATSVISRIMHRVLVENWAAEKAVEEAHKKVVEIYARQQQES*
Ga0126374_103560123	3300009792	Tropical Forest Soil	HTYVLGRMMHRVLVENWEAEKAVEEAHKKTVEIYARHQEA*
Ga0126374_105772801	3300009792	Tropical Forest Soil	HMMHRVLVEAWEVEKAVAEAHKKVAEIYARHQEEG*
Ga0105059_10284482	3300009795	Groundwater Sand	RMMHRVLVESWEAEKAVEEAHKKVAEIYARHQES*
Ga0105061_10807321	3300009807	Groundwater Sand	GEVLATFVIGRMMHRVLVENWDVEKAVVEAHKKVAEIYARHQKG*
Ga0126380_119244681	3300010043	Tropical Forest Soil	TYVIGHMMHRVLVEAWEVEKAVAEAHKKVAEIYARHQEEG*
Ga0126382_101322192	3300010047	Tropical Forest Soil	TIGHMIQRVLVENWEAEKAVEEAHKKVVEIYARYQEA*
Ga0126382_103145321	3300010047	Tropical Forest Soil	VSSTYVIGRMMHRVLVDYWAAEKAVEEAHKKAVEIYARYQEG*
Ga0126382_109946931	3300010047	Tropical Forest Soil	LATFVIGRMMHRVLVENWNAEKAVEEAHKRVAEIYARYQGT*
Ga0126382_111855362	3300010047	Tropical Forest Soil	YTIGHMIQRVLVENWEAEKAVEEAHKKVVEIYARY*
Ga0126382_122157901	3300010047	Tropical Forest Soil	IGRMMHRVLVENWNVEKAVVEAHKKVADIYARHNKG*
Ga0127460_10542221	3300010114	Grasslands Soil	RVMHRVLVEHWEVEKAVEETHKQVAEIYARHAAG*
Ga0126306_113857562	3300010166	Serpentine Soil	ISRMVHWVLVENWEVEKAVEEAHKKVVEIYARYGEG*
Ga0126376_129583242	3300010359	Tropical Forest Soil	MMHRVLVENWEAEKAAEEAHKKVAEIYARQGEEG*
Ga0126377_118712771	3300010362	Tropical Forest Soil	TFTIGHMIQRVLVENWEAEKAVEEAHKKVVEIYARYQEG*
Ga0126377_127224891	3300010362	Tropical Forest Soil	ATYVIGHMLHRVLVESWEVEKAVEEAHKKVAEIYARHQEEG*
Ga0126377_134594642	3300010362	Tropical Forest Soil	VIGRMLHRVLVENWEAEKAVEEAHKKVVEIYARYPQG*
Ga0136847_119425371	3300010391	Freshwater Sediment	TFVIGRMMHRVLVENWNVEKAVVEAHKKVAEIYARHQAASGR*
Ga0126383_114393701	3300010398	Tropical Forest Soil	LGTYTIGHMIQRVLVENWEAEKAVEEAHKKVAEIYARYQEA*
Ga0134127_105683671	3300010399	Terrestrial Soil	SGEVLATYTIGRMMHRVLVESWNVEKAVVEAHKKAQDIYSRYQGA*
Ga0137391_101958261	3300011270	Vadose Zone Soil	TFVIGHMMHRVLVESWEAEKAVEEAHKKVVEIYARYQEG*
Ga0137393_108158011	3300011271	Vadose Zone Soil	IGHMMHRVLVESWEAEKAVVEAHKKVVEIYARYQEG*
Ga0137383_101456751	3300012199	Vadose Zone Soil	TYVIGHMLHRVLVDTWEAEKAVEEAHKKVAAIYARYQEE*
Ga0137362_114237901	3300012205	Vadose Zone Soil	SGEVLATYVIGHMMHRVLVENWEAEKAVEEAHKKAVEIYARYAEG*
Ga0137379_112757212	3300012209	Vadose Zone Soil	ATYVIGHMIQRVLVESWEAEKAVAEAHKKVAEIYARYQEE*
Ga0137378_101404372	3300012210	Vadose Zone Soil	GEVMHTYVLGRMMHRVLVENWAAEKAVEEAHKKIVEIYARYQEA*
Ga0137377_113224622	3300012211	Vadose Zone Soil	FSTYVIGRMMHRVLVENWEAEKAVEEAHKKVAEIYARHQEA*
Ga0137387_109079462	3300012349	Vadose Zone Soil	LGTYTIGHMIQRVLVEHWEAEKAVEETHKQVAEIYARHAAG*
Ga0137387_112975903	3300012349	Vadose Zone Soil	VGEVMHTYVIGRMMHRVLVENWESEKAVEEAHKKSVEIYARHQEV*
Ga0137386_106329272	3300012351	Vadose Zone Soil	ATYTIGHMLHRVLVENWEAEKAVEEAHKKVVEIYARYQEA*
Ga0137367_107501733	3300012353	Vadose Zone Soil	VMHTYVLGRMMHRVLVENWEAEKAVEEAHKKTVEIYARHQEV*
Ga0137369_102178771	3300012355	Vadose Zone Soil	STYVMGRMMHRVLVENWEAEKAVEEAHKKVAEIYARHQEA*
Ga0137390_116118042	3300012363	Vadose Zone Soil	VLATFVIGRMMHRVLVESWNVEKAVVEAHKKAAEIYARHQAG*
Ga0134043_12913871	3300012392	Grasslands Soil	RMMHRVLVENWEAEKAVEEAHKQVAEIYARHQEA*
Ga0137373_102740061	3300012532	Vadose Zone Soil	MARMMHRVLVEHWEVEKAVEETHKQVAEIYARHAAG*
Ga0137397_106968823	3300012685	Vadose Zone Soil	VLATYVIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA*
Ga0137395_101830423	3300012917	Vadose Zone Soil	EVMHTYVRGRMMHRVLVESWEAEKAVEEAHKKIAEIYARHQEA*
Ga0137396_110719531	3300012918	Vadose Zone Soil	IGRMMHRVLVESWNVEKAVVEAHRKVAEIYARYQGA*
Ga0137394_107244663	3300012922	Vadose Zone Soil	AGEVLATYVIGRMMHRVLVESWNVEKAVEEAHKKVVEIYKRHQVG*
Ga0137394_112518752	3300012922	Vadose Zone Soil	EVLATYVLGRMMHRVLVESWNAEKAVVEAHKKVAEIYARHQAA*
Ga0137404_110722481	3300012929	Vadose Zone Soil	EVTGTYVMGRMIQRVLVEHWEAEKAVEEAHKKVVAMYARYPEG*
Ga0137410_112161261	3300012944	Vadose Zone Soil	LGHMIQRVLVDNWEAEKAVEEAHKKVVEIYARYPEG*
Ga0126375_117443612	3300012948	Tropical Forest Soil	TIGHMIQRVLVENWEAEKAVEEAHKKVVEIYARYPEA*
Ga0126369_125672371	3300012971	Tropical Forest Soil	VLQRAVVLPHTLHRVLVENWEAAQAVEEAHKKAVEIYAHHQ
Ga0163162_105735161	3300013306	Switchgrass Rhizosphere	GEVLTTYVIGRMIQRVLVESWEVEKAVEEAHKQIAEIYARYQEA*
Ga0134075_100161245	3300014154	Grasslands Soil	GEVLATYVIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARHQAG*
Ga0137405_13587876	3300015053	Vadose Zone Soil	VLATFVIGRMMHRVLVESWNAEKAVVEAHKKVAEIYKRHQAG*
Ga0180079_10260021	3300015248	Soil	VLATYTIGRMMHRVLVESWPAEKAVEEAHKKAAEIYARYQKG*
Ga0182038_113851211	3300016445	Soil	VGTTYVIARMMHRVLVEYWEAEKAVEETHKQVAEIYARHAAG
Ga0163161_112846602	3300017792	Switchgrass Rhizosphere	TFVIGRMMHRVLVESWNVEKAVEEAHKKVAEIYARHQA
Ga0184612_104095891	3300018078	Groundwater Sediment	SHNPASGEVLATFVLGRMMHRVLVESWNVEKAVVEAHKKVAEIYARHQAG
Ga0066667_103169151	3300018433	Grasslands Soil	EVLATYTIGHMLHRVLVENWEAEKAVEEAHKKVAEIYARYQEA
Ga0190268_115593951	3300018466	Soil	AAGEVLATFTIGRMMHRVLVESWPAEKAVEEAHKKVATIYARYQGG
Ga0184645_10026322	3300019233	Groundwater Sediment	VGEVGTTYVMARMMHRVLVEHWEAEKAVEETHKQVAEIYARHAAG
Ga0180117_14039921	3300019248	Groundwater Sediment	MHTYVLGRMMHRVLVENWEVEKAVEEAHKKTVEIYARHQEA
Ga0184646_11820141	3300019259	Groundwater Sediment	VTNVISRMVHWVLVENWEAEKAVEEAHKKVVEIYARYAEG
Ga0194128_101553682	3300020197	Freshwater Lake	VVATNVLARMMHRVLIENWEVEKAVEEAHKKVVEIYARAAQAG
Ga0209827_110821661	3300025149	Thermal Springs	VFATSVISRIMHRVLVENWAAEKAVEEAHKKVVEIYARQQQES
Ga0207684_103459542	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	ATQVISRTMHRVLVENWEAEKAVEEAHKKAAEIYARHQVGSY
Ga0207646_102536673	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	TQVISRTMHRVLVENWEAEKAVEEAHKKAAEIYARHQVGS
Ga0207646_102644194	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	VFSTYVIGRMMHRVLVETWEAEKAVEEAHKKTAEIYARHQEG
Ga0209690_12465161	3300026524	Soil	LATFVIGRMMHRVLVESWNVEKAVVEAHQKVVEIYKRHQAG
Ga0256867_102467172	3300026535	Soil	AGEIYATGVLARMMHRVLVDNVEAEKAVEEAHKNVVEIYARWPEG
Ga0209077_11657412	3300027675	Freshwater Sediment	VTTTMARMMHRVLVENWEAEKAVEDAHKKVVDIYARYPEG
Ga0209814_101501281	3300027873	Populus Rhizosphere	AGEVLATYVIGRMMHRVLVESWNVEKAVVEAHKKAQDIYNRYQGA
Ga0209465_100985131	3300027874	Tropical Forest Soil	VIGRMIHRVLVEHWEAEKAVEEAHKKVVEIYARYQEA
Ga0209590_104058312	3300027882	Vadose Zone Soil	MPRMMHRALVENLEAEKAVEEAHKKVVEIYAHNQEES
Ga0209382_105716882	3300027909	Populus Rhizosphere	AGEVLATSVLARMMHRVLVESWEAEPAVEEAHKKVVEIYARYPEG
Ga0209857_10601421	3300027957	Groundwater Sand	SVMSRIMHRVLVENWEAEKAVEEAHKKAAEIYARHQKG
Ga0209853_10258381	3300027961	Groundwater Sand	ATFVIGRMMHRVLVESWDVEKAVVEAHKKVAEIYARHQKG
Ga0257175_10156411	3300028673	Soil	VLATFVIGRMMHRVLVESWNVEKAVVEAHKKAAEIYARHQAG
Ga0299907_110372242	3300030006	Soil	EIYATGVLARMMHRVLVDNVEAEKAVEDAHKNVVEIYARWPEG
Ga0299907_112688952	3300030006	Soil	LARMVQQVLVENREPEKAVEEAHKRVVEIYARYQEG
Ga0247648_10899982	3300030574	Soil	GNVLARMMQRVLVESWEAEKAVEEAHKKVVEIYARSDG
Ga0247651_100543881	3300030608	Soil	TNVIARMMHHVLVENWEAEKAVEEAHKKAVEIYARHAAGG
Ga0308205_10480541	3300030830	Soil	LIGRMMHRVLVENWEAEKAVEEAHKKTVEIYARHQEA
Ga0308202_10988942	3300030902	Soil	YMLGRMMHRVLVENWEAEKAVEEAHKKTAEIYARHQEG
Ga0308204_100061112	3300031092	Soil	ASGEVLATYTIGRMLHRVLVENWEAERAVEEAHKKVVEIYARYQEA
Ga0308204_100252572	3300031092	Soil	ATNVLSHMVQRVLVENVAAEKAVEEAHKQVVEIYARFQG
Ga0308204_101836642	3300031092	Soil	EVYATNVLARMTQRVLIENLEAEKAVEEAHKKVAEIYARYQEV
Ga0318515_107102002	3300031572	Soil	VIGRMMHRVLVESWNVEKAVVEAHKKVADIYARYQGA
Ga0310900_102882351	3300031908	Soil	VLATFTLGHMMHRVLVENWEAEKAVEEAHKKVVDIYARYQEA
Ga0310900_109902051	3300031908	Soil	SSTYVIGRMMHRVLVENWEAEKAVEEAHKKIVEIYARHQEA
Ga0307471_1003561393	3300032180	Hardwood Forest Soil	GRMMHRVLVENWNVEKAVVEAHQKVAQVYARHAKG
Ga0307471_1022867783	3300032180	Hardwood Forest Soil	TYTIGRMMHRVLVESWNAEKAVVEAHKKVAEIYARHQKG
Ga0307472_1024087822	3300032205	Hardwood Forest Soil	TDVLAHMMHRVLVENWEAEKAVEEAHHQVVAIYARYPEG
Ga0314780_178834_408_536	3300034659	Soil	VLATYTIGRMLHHVLVENWEAEKAVEEAHKKVVEIYARYPEG
Ga0314801_178557_21_149	3300034676	Soil	VLATYTIGRMLQRVLVENWEAEKAVEEAHKKVVEIYARYPEG

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign