NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F040285

Metagenome / Metatranscriptome Family F040285

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040285
Family Type Metagenome / Metatranscriptome
Number of Sequences 162
Average Sequence Length 46 residues
Representative Sequence IAAGDLPVERVVTSNVTLDDAPDAFARLASGAADEIKVLVDQ
Number of Associated Samples 144
Number of Associated Scaffolds 162

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.38 %
% of genes from short scaffolds (< 2000 bps) 97.53 %
Associated GOLD sequencing projects 136
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (65.432 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(12.963 % of family members)
Environment Ontology (ENVO) Unclassified
(36.420 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(50.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.57%    β-sheet: 20.00%    Coil/Unstructured: 61.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 162 Family Scaffolds
PF08240ADH_N 94.44
PF13823ADH_N_assoc 2.47
PF07883Cupin_2 1.23



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A65.43 %
All OrganismsrootAll Organisms34.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725004|GPKC_F5OHE3B02FZR2ONot Available500Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig518396Not Available864Open in IMG/M
2170459017|G14TP7Y01B10Y5Not Available649Open in IMG/M
3300000550|F24TB_14794088Not Available548Open in IMG/M
3300002245|JGIcombinedJ26739_101622556Not Available544Open in IMG/M
3300004114|Ga0062593_101786796All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300004156|Ga0062589_101520287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300004479|Ga0062595_102201886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300004803|Ga0058862_12398528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300005167|Ga0066672_10962342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300005327|Ga0070658_10923191All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300005329|Ga0070683_101517516All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300005331|Ga0070670_101887786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300005337|Ga0070682_100065500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2309Open in IMG/M
3300005356|Ga0070674_100243297All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300005367|Ga0070667_101832928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300005435|Ga0070714_101141405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria760Open in IMG/M
3300005435|Ga0070714_102054855All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005437|Ga0070710_11231684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300005441|Ga0070700_100122869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1742Open in IMG/M
3300005446|Ga0066686_10962035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300005458|Ga0070681_11166179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria692Open in IMG/M
3300005467|Ga0070706_101558348Not Available603Open in IMG/M
3300005536|Ga0070697_101304412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria648Open in IMG/M
3300005539|Ga0068853_100632033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1018Open in IMG/M
3300005544|Ga0070686_100715299All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300005566|Ga0066693_10358859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli588Open in IMG/M
3300005616|Ga0068852_101740738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria646Open in IMG/M
3300005616|Ga0068852_102793128All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300005834|Ga0068851_10609123Not Available665Open in IMG/M
3300005840|Ga0068870_10682565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli707Open in IMG/M
3300006028|Ga0070717_10812214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria851Open in IMG/M
3300006034|Ga0066656_10620081All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300006046|Ga0066652_101902845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli534Open in IMG/M
3300006058|Ga0075432_10562431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300006173|Ga0070716_100361465All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300006175|Ga0070712_101118368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria684Open in IMG/M
3300006175|Ga0070712_101446371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli600Open in IMG/M
3300006354|Ga0075021_10525982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli751Open in IMG/M
3300006578|Ga0074059_11913633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria546Open in IMG/M
3300006605|Ga0074057_11947008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300006755|Ga0079222_11146608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria689Open in IMG/M
3300006755|Ga0079222_11557120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300006800|Ga0066660_11477574All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300006804|Ga0079221_10725560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300006852|Ga0075433_10349786All Organisms → cellular organisms → Bacteria1306Open in IMG/M
3300006852|Ga0075433_11474246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli588Open in IMG/M
3300006881|Ga0068865_101025364All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300006954|Ga0079219_10278546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1018Open in IMG/M
3300009011|Ga0105251_10441726Not Available602Open in IMG/M
3300009093|Ga0105240_12228637Not Available568Open in IMG/M
3300009094|Ga0111539_10071166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4104Open in IMG/M
3300009098|Ga0105245_10328768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1508Open in IMG/M
3300009100|Ga0075418_10450708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1378Open in IMG/M
3300009137|Ga0066709_100472970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1758Open in IMG/M
3300009137|Ga0066709_100945553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1259Open in IMG/M
3300009137|Ga0066709_102784150Not Available649Open in IMG/M
3300009137|Ga0066709_104045440Not Available533Open in IMG/M
3300009156|Ga0111538_11980526Not Available733Open in IMG/M
3300009174|Ga0105241_12522854Not Available515Open in IMG/M
3300009551|Ga0105238_11228296Not Available774Open in IMG/M
3300009551|Ga0105238_12702819Not Available533Open in IMG/M
3300010036|Ga0126305_10381454Not Available927Open in IMG/M
3300010041|Ga0126312_10902895Not Available644Open in IMG/M
3300010042|Ga0126314_10401511Not Available988Open in IMG/M
3300010044|Ga0126310_10613903Not Available813Open in IMG/M
3300010152|Ga0126318_10829655Not Available506Open in IMG/M
3300010152|Ga0126318_10858232Not Available679Open in IMG/M
3300010321|Ga0134067_10309573Not Available611Open in IMG/M
3300010362|Ga0126377_13512018Not Available507Open in IMG/M
3300010366|Ga0126379_12159151Not Available658Open in IMG/M
3300010375|Ga0105239_12486462Not Available603Open in IMG/M
3300010396|Ga0134126_10902739Not Available994Open in IMG/M
3300010397|Ga0134124_12054376Not Available609Open in IMG/M
3300010399|Ga0134127_13707874Not Available502Open in IMG/M
3300011119|Ga0105246_10927255Not Available783Open in IMG/M
3300012011|Ga0120152_1112465Not Available758Open in IMG/M
3300012198|Ga0137364_10860443Not Available685Open in IMG/M
3300012209|Ga0137379_10435918Not Available1219Open in IMG/M
3300012210|Ga0137378_11036359Not Available734Open in IMG/M
3300012211|Ga0137377_10837159Not Available852Open in IMG/M
3300012212|Ga0150985_115024545Not Available510Open in IMG/M
3300012492|Ga0157335_1031122Not Available560Open in IMG/M
3300012905|Ga0157296_10315056Not Available553Open in IMG/M
3300012906|Ga0157295_10113405Not Available763Open in IMG/M
3300012911|Ga0157301_10207612Not Available663Open in IMG/M
3300012917|Ga0137395_10747094Not Available708Open in IMG/M
3300012955|Ga0164298_11455717Not Available533Open in IMG/M
3300012957|Ga0164303_10533453Not Available758Open in IMG/M
3300012958|Ga0164299_10799659Not Available672Open in IMG/M
3300012975|Ga0134110_10493761Not Available556Open in IMG/M
3300012984|Ga0164309_11875050Not Available514Open in IMG/M
3300012986|Ga0164304_10897382Not Available693Open in IMG/M
3300012987|Ga0164307_11474577Not Available575Open in IMG/M
3300013296|Ga0157374_11989366Not Available607Open in IMG/M
3300013297|Ga0157378_11468036Not Available726Open in IMG/M
3300013297|Ga0157378_12990054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli524Open in IMG/M
3300013306|Ga0163162_10052217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli4105Open in IMG/M
3300013306|Ga0163162_11253092Not Available842Open in IMG/M
3300013306|Ga0163162_11962898Not Available670Open in IMG/M
3300013308|Ga0157375_12304894Not Available642Open in IMG/M
3300014497|Ga0182008_10994654Not Available500Open in IMG/M
3300014745|Ga0157377_10828997Not Available685Open in IMG/M
3300014968|Ga0157379_10376426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1302Open in IMG/M
3300015371|Ga0132258_11202533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1916Open in IMG/M
3300015372|Ga0132256_103138631Not Available556Open in IMG/M
3300015373|Ga0132257_102809173Not Available635Open in IMG/M
3300015373|Ga0132257_103056892Not Available609Open in IMG/M
3300016422|Ga0182039_10909115Not Available786Open in IMG/M
3300017936|Ga0187821_10304133Not Available634Open in IMG/M
3300018063|Ga0184637_10594546Not Available627Open in IMG/M
3300018077|Ga0184633_10332173Not Available770Open in IMG/M
3300018082|Ga0184639_10398055Not Available711Open in IMG/M
3300018482|Ga0066669_11927262Not Available551Open in IMG/M
3300019356|Ga0173481_10596607Not Available580Open in IMG/M
3300019885|Ga0193747_1042283Not Available1136Open in IMG/M
3300019888|Ga0193751_1165446Not Available778Open in IMG/M
3300020082|Ga0206353_11608081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1564Open in IMG/M
3300021073|Ga0210378_10293388Not Available612Open in IMG/M
3300023057|Ga0247797_1006930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1278Open in IMG/M
3300023102|Ga0247754_1008929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2051Open in IMG/M
3300025910|Ga0207684_11214698Not Available624Open in IMG/M
3300025911|Ga0207654_11067069Not Available588Open in IMG/M
3300025914|Ga0207671_11535445Not Available513Open in IMG/M
3300025916|Ga0207663_11634217Not Available518Open in IMG/M
3300025920|Ga0207649_10759952Not Available755Open in IMG/M
3300025920|Ga0207649_11043873Not Available644Open in IMG/M
3300025922|Ga0207646_11472978Not Available590Open in IMG/M
3300025924|Ga0207694_10708609Not Available849Open in IMG/M
3300025924|Ga0207694_11417435Not Available587Open in IMG/M
3300025926|Ga0207659_10404852Not Available1142Open in IMG/M
3300025932|Ga0207690_10381841Not Available1120Open in IMG/M
3300025932|Ga0207690_11360014Not Available594Open in IMG/M
3300025949|Ga0207667_11424646Not Available666Open in IMG/M
3300025972|Ga0207668_12157194Not Available501Open in IMG/M
3300025981|Ga0207640_11392600Not Available628Open in IMG/M
3300025986|Ga0207658_10363657Not Available1263Open in IMG/M
3300026075|Ga0207708_11652541Not Available563Open in IMG/M
3300026121|Ga0207683_11708021Not Available579Open in IMG/M
3300026142|Ga0207698_11977913Not Available597Open in IMG/M
3300026300|Ga0209027_1235117Not Available587Open in IMG/M
3300026318|Ga0209471_1272540Not Available568Open in IMG/M
3300027725|Ga0209178_1387375Not Available529Open in IMG/M
3300028293|Ga0247662_1055690Not Available692Open in IMG/M
3300028380|Ga0268265_11801198Not Available619Open in IMG/M
3300028587|Ga0247828_11031269Not Available540Open in IMG/M
3300028717|Ga0307298_10271289Not Available506Open in IMG/M
3300028744|Ga0307318_10119786Not Available896Open in IMG/M
3300028771|Ga0307320_10468016Not Available509Open in IMG/M
3300028796|Ga0307287_10262448Not Available654Open in IMG/M
3300028802|Ga0307503_10658232Not Available584Open in IMG/M
3300028807|Ga0307305_10059559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1760Open in IMG/M
3300028811|Ga0307292_10147483Not Available949Open in IMG/M
3300028876|Ga0307286_10258574Not Available638Open in IMG/M
3300028884|Ga0307308_10138368Not Available1165Open in IMG/M
3300028889|Ga0247827_10729777Not Available649Open in IMG/M
3300031726|Ga0302321_102740184Not Available576Open in IMG/M
3300031918|Ga0311367_11793707Not Available596Open in IMG/M
3300031995|Ga0307409_100202534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1777Open in IMG/M
3300031995|Ga0307409_102021738Not Available606Open in IMG/M
3300032017|Ga0310899_10311584Not Available733Open in IMG/M
3300032074|Ga0308173_12278998Not Available511Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere5.56%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.32%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.70%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.70%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.09%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.09%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.09%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.09%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.47%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.85%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.23%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.23%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.23%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.23%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.23%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.23%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.62%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.62%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.62%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.62%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.62%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.62%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.62%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.62%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.62%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.62%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.62%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.62%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725004Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012492Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610Host-AssociatedOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300023102Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300028293Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPKC_079453402067725004SoilWVYDFDRIAAQISAGDLPVERVVTSTVTLDRAPDMFAQLASGEADEMKVLVDQ
KansclcFeb2_053637702124908045SoilAGGLPVERVVTRTIGLEDAPDAFAALASGSADEIKVLIDQ
4ZMR_044014802170459017Switchgrass, Maize And Mischanthus LitterQIAAGDLPVERVVTSGVGLDDAPDAFERLASGAADEIKVLVER
F24TB_1479408813300000550SoilCYWVYDFDRIAAQIEAGDLPVERAVTSNVILDDAPDAFARLASGTADEIKELIDHEE*
JGIcombinedJ26739_10162255623300002245Forest SoilERVVTSSVALDGAPGAFALLASGTADEIKVLVDQ*
Ga0062593_10178679623300004114SoilAGDLPVERVVTSQVDLDGAPDAFARLASGAADEIKVLVDQ*
Ga0062589_10152028723300004156SoilYWVYDFDRIAAQIAAGDLPVERVVTSHVGLDDAPGAFELLASGTADEMKILIDQ*
Ga0062595_10220188623300004479SoilRIAAQIAAGDLPVERAVTSAVALDDAPDAFARLASGTADEIKVLIDHE*
Ga0058862_1239852813300004803Host-AssociatedVYDFDRIAAQIASGSLPVERVVTSTVSLDGAPDAFAMLASGTADEIKVLVEQ*
Ga0066672_1096234213300005167SoilWVYDFDRIAAQIAAGDLPVERVITSNVGLEEAPDAFARLASGSADEIKVLVEQ*
Ga0070658_1092319123300005327Corn RhizosphereWVYDFDRIAAQIAAGDLPVERIVTRTARLDDAPDVFAQLASGKADEIKVLIDQ*
Ga0070683_10151751613300005329Corn RhizosphereTWCYWVYDFDRVAAQIAAGDLPVERVVTSHVGLDGSPDAFERLASGAADEIKVLIDQ*
Ga0070670_10188778623300005331Switchgrass RhizosphereGDLPVERVVTRTIGLGDAPDAFAALASGTADEIKVLIDQ*
Ga0070682_10006550033300005337Corn RhizosphereTWCYWVYDFDRIAAQIGTGSLPVERVVTSSVALGDAPDAFARLASGAADEIKVLVDQ*
Ga0070674_10024329713300005356Miscanthus RhizosphereRVAAQIAAGDLPVERVVTSHVALDDAPDAFERLASGAADEIKVLIDQ*
Ga0070667_10183292813300005367Switchgrass RhizosphereCYWVYDFERIAAQIAAGDLPVERVITGSRTLDDAPDAFASLASGKADEIKVLINQ*
Ga0070714_10114140523300005435Agricultural SoilRIVSQIATGSLPVERVITSGVTLDGAPDAFARLASGTADEIKVLIDQ*
Ga0070714_10205485523300005435Agricultural SoilWCYWVYDFDRIAAQIGTGNLPVERVVTSNVSLDDAPEAFQRLASGAADEIKVLVDH*
Ga0070710_1123168423300005437Corn, Switchgrass And Miscanthus RhizosphereYWVYDFDRIAAQIGTGNLPVERVVTSNVSLDDAPEAFQRLASGAADEIKVLVDH*
Ga0070700_10012286913300005441Corn, Switchgrass And Miscanthus RhizosphereAQIAAGDLPVERVVTRTIGLGDAPDAFAALASGTADEIKVLIDQ*
Ga0066686_1096203513300005446SoilIAAGDLPVERVVTSNVTLDDAPDAFARLASGAADEIKVLVDQ*
Ga0070681_1116617923300005458Corn RhizosphereQIAAGDLPVERVITSNVGLDEAPDAFARLASGSADEIKVLVDQ*
Ga0070706_10155834813300005467Corn, Switchgrass And Miscanthus RhizosphereYDFDRIAAQIEAGDLPVERAVTSNVILDDAPDAFARLASGTADEIKVLIDHEE*
Ga0070697_10130441223300005536Corn, Switchgrass And Miscanthus RhizosphereQIAAGSLPVERIVTSRDTLDGAPDAFARLASGAADEIKVLIDQ*
Ga0068853_10063203313300005539Corn RhizosphereYDFDRIAAQIASGSLPVERVVTSTVSLDGAPDAFAMLASGTADEIKVLVEQ*
Ga0070686_10071529923300005544Switchgrass RhizosphereGDLPVERVVTSHVELDGAPDAFERLASGAADEIKVLIDQ*
Ga0066693_1035885913300005566SoilTWCYWVYDFDRIAAQIAAGDLPVERVVTSSVALDGAPDAFAQLASGTADEIKVLVEQ*
Ga0068852_10174073813300005616Corn RhizosphereFDRIVAQIAAGDLPVERIVTRTVPLDDAPDVFAQLASGKADEIKVSIDQ*
Ga0068852_10279312823300005616Corn RhizosphereGDLPVERVITSGVELDEAPEAFARLASGAADEIKVLVER*
Ga0068851_1060912313300005834Corn RhizosphereERVITSSTSLDGAPDAFARLASGTADEMKVLINQ*
Ga0068870_1068256513300005840Miscanthus RhizosphereWCYWVYDFDRIAAQIAAGDLPVERVVTGRVDLDGAPEAFARLASGTADEIKVLIDQ*
Ga0070717_1081221413300006028Corn, Switchgrass And Miscanthus RhizosphereFDRIAAQIAAGDLPVERVVTSSVDLDRAPDAFEQLASGGADEIKVLVEQ*
Ga0066656_1062008113300006034SoilYWVYDFDRIAAQISAGDLPVERVVTSTVTLDGAHNAFARLASGAADEIKVLVDQ*
Ga0066652_10190284513300006046SoilTWCYWVYDFDRIAAQIAAGDLPVERVVTSTVTLDDAPEAFARLASGAADEIKVLVDQ*
Ga0075432_1056243113300006058Populus RhizosphereVYDFDRIAAQIAAGDLPVERVVTRTIGLDDAPDAFAELASGTADEIKVLIDQ*
Ga0070716_10036146523300006173Corn, Switchgrass And Miscanthus RhizosphereTWCYWVYDFDRIAAQIAAGDLPVERVVTSSAALDDAPHAFERLASGAADEIKVLIDQ*
Ga0070712_10111836813300006175Corn, Switchgrass And Miscanthus RhizosphereGTLPVERVVTSTVLLGDAPGAFERLASGGADEIKVLVDQ*
Ga0070712_10144637123300006175Corn, Switchgrass And Miscanthus RhizosphereWCYWVYDFDRIAAQIAAGDLPVERVITSQVGLTEAPEAFERLASGTADEIKVLVNQ*
Ga0075021_1052598223300006354WatershedsCYWVYDFDRIAAQIAAGDLPVERVITSSVTLDGAPDAFALLASGTADEIKVLIDQ*
Ga0074059_1191363313300006578SoilWVYDFERIAAQIAAGDLPVERVVTSSGALDDAPGAFASLASGEADEIKVLINQ*
Ga0074057_1194700823300006605SoilTWCYWVYDFERIAAQIAAGDLPVERVVTSSGALDDAPGAFASLASGEADEIKVLINQ*
Ga0079222_1114660823300006755Agricultural SoilLPVERVITSNVTLDDAPDAFDRLASGTADEIKVLIDQ*
Ga0079222_1155712023300006755Agricultural SoilAAQIAAGDLPVERVVTSTHSLDEAPDAFAMLASGSADEIKVLIDQQGETR*
Ga0066660_1147757423300006800SoilRLPVEKIITSTVGLDDAPESFAQLASGSASEIKVLVDQ*
Ga0079221_1072556013300006804Agricultural SoilIASQIAAGDLPVERVVTSSATLDDAPEAFARLASGTADEIKVLIDQ*
Ga0075433_1034978613300006852Populus RhizosphereRVAAQIAAGSLPVERVITSKVSLDDSPDAFERLASGTADEIKILVEQ*
Ga0075433_1147424623300006852Populus RhizosphereTWCYWVYDFDRIAAQIAAGDLPVERVVTGRVDLDGAPEAFARLASGTADEIKVLIDQ*
Ga0068865_10102536423300006881Miscanthus RhizosphereTWCYWVYDFDRVAAQIAAGDLPVERVVTSHVELDGAPDAFERLASGAADEIKVLIDQ*
Ga0079219_1027854613300006954Agricultural SoilQIGAGSLPVERVITSTVGLDDAPDAFARLASGAADEIKVLVVQ*
Ga0105251_1044172623300009011Switchgrass RhizosphereYWVYDFDRVAAQIAAGDLPVERVVTSHVGLDDAPDAFERLASGAADEIKVLIDQ*
Ga0105240_1222863713300009093Corn RhizosphereTWCYWVYDFDRVAAQIGAGTLPVERVITSTITLGEAPGAFERLASGSADEIKILIDQ*
Ga0111539_1007116613300009094Populus RhizosphereAQIAAGDLPVERIVTRTARLDDAPDVFAQLASGKADEIKVLIDE*
Ga0105245_1032876813300009098Miscanthus RhizosphereDLPVERIVTRTVPLDDAPDVFAQLASGKADEIKVLIDQ*
Ga0075418_1045070813300009100Populus RhizosphereTWCYWVYDFDRVAAQIAAGDLPVERVVTSHVTLDDAPDAFERLASGAADEIKVLIDQ*
Ga0066709_10047297033300009137Grasslands SoilRLPVEKIITSTVGLDEAPESFAQLASGSASEIKVLVDQ*
Ga0066709_10094555333300009137Grasslands SoilERVVTSNVTLDAAPDAFARLASGAADEIKVLIDQ*
Ga0066709_10278415013300009137Grasslands SoilRIAAQIAAGDLPVERVVTSNVTLDDAPEAFARLASGAADEIKVLIDQ*
Ga0066709_10404544013300009137Grasslands SoilPVERTVTSNVILDDAPDAFARLASGAADEIKVLIDHEE*
Ga0111538_1198052613300009156Populus RhizosphereLPVERVVTGRVDLDGAPEAFARLASGTADEIKVLIDQ*
Ga0105241_1252285423300009174Corn RhizospherePVERVVTSQVDLDGAPDAFARLASGAADEIKVLVDQ*
Ga0105238_1122829613300009551Corn RhizosphereAAGDLPVERVITGSRTLDDAPDAFASLASGKADEIKVLINQ*
Ga0105238_1270281923300009551Corn RhizosphereRIAAQIAAGDLPVERVVTRTIGLGDAPDAFAALASGTADEIKVLIDQ*
Ga0126305_1038145423300010036Serpentine SoilYWVYDFDRIAAQIGAGSLPVERVITSNVPLADAPDAFARLASGAADEIKILVDQ*
Ga0126312_1090289523300010041Serpentine SoilRVVTSTIGLDEAPAAFSDLASGNADEIKVLIRLGEVE*
Ga0126314_1040151113300010042Serpentine SoilASQIAAGSLPVERVITSSVGLDESPDAFARLASGSADEIKVLVDQ*
Ga0126310_1061390313300010044Serpentine SoilERVITSNVPLADAPDAFARLASGAADEIKILVDQ*
Ga0126318_1082965513300010152SoilAGSLPVERVITSTVRLDDAPDAFSRLASGAADEIKVLVAQ*
Ga0126318_1085823223300010152SoilYDFDRIAAQIAAGSLPVERVVTSTVTLDNAPDAFAMLASGTADEIKVLVEQ*
Ga0134067_1030957313300010321Grasslands SoilRIASQIAAGALPVERVVTSNVTLDDAPDAFARLASGAADEIKVLIDQ*
Ga0126377_1351201813300010362Tropical Forest SoilQIAAGDLPVERVVTSSATLDDAPDAFARLASGTADEIKVLIDQ*
Ga0126379_1215915123300010366Tropical Forest SoilWCYWVYDFDRIAAQIAAGDLPVERVVTSNTTLDAAPDAFERLASGAADETKVLIDQ*
Ga0105239_1248646213300010375Corn RhizosphereAQIAAGDLPVERVVTSEVDLDGAPDAFARLASGAADEIKVLVDQ*
Ga0134126_1090273913300010396Terrestrial SoilAAGDLPVERVITSSVELDGAPDAFAQLASGAADEIKVLVEQ*
Ga0134124_1205437623300010397Terrestrial SoilYDFDRVAAQIAGGGLPVERVITGKVGLDDAPAAFERLASGTADEIKVLVAQ*
Ga0134127_1370787413300010399Terrestrial SoilDFDRIAAQIAAGDLPVERVVTGRVDLDGAPEAFARLASGTADEIKVLIDQ*
Ga0105246_1092725513300011119Miscanthus RhizosphereFDRVAAQIAAGDLPVERVVTSHVELDGAPDAFERLASGAADEIKVLIDQ*
Ga0120152_111246513300012011PermafrostRRSPSTPIAAQIAAGSLPVERVVTSSVTLDGAPDAFARLASGAADEIKVMVDQ*
Ga0137364_1086044313300012198Vadose Zone SoilERVVTSEIDLEGAPDAFARLASGAADEIKVLIDQ*
Ga0137379_1043591813300012209Vadose Zone SoilFDRIAAQIAAGDLPVERVVTSRVGVDGTPDAFALLASGAADEIKVLVDQ*
Ga0137378_1103635913300012210Vadose Zone SoilDRIAAQIAAGDLPVERVVTGNIPLDGAQDAFARLASGVADEIKVLIDQ*
Ga0137377_1083715923300012211Vadose Zone SoilIAAQIAAGDLPVERIVTSNVTMDDAPDAFARLASGAADEIKVLIDQ*
Ga0150985_11502454523300012212Avena Fatua RhizosphereDFDRIAAQIAAGRLPVERVVTSSATLDGAPDAFERLASGAADEIKVLIDQ*
Ga0157335_103112223300012492Arabidopsis RhizosphereDRVVTSEVELDGAPDAFARLASGAADEIKVLIDQ*
Ga0157296_1031505623300012905SoilIAAGDLPVDRVVTSEVELDGAPDAFARLASGAADEIKVLIDQ*
Ga0157295_1011340513300012906SoilPVERVVTSHVELDGAPDAFERLASGAADEIKVLIDQ*
Ga0157301_1020761213300012911SoilCYWVYDFDRIAAQIAAGDLPVERVETGRVDLEGAPEAFARLASGTADEIKVLIDQ*
Ga0137395_1074709423300012917Vadose Zone SoilQIGAGSLPVERVVTSSVTLDDAPDAFARLASGAADEIKVLVNQ*
Ga0164298_1145571713300012955SoilIGTGSLPVERVITSTVTLDGAPDAFARLASGGADEIKVLVDQ*
Ga0164303_1053345313300012957SoilDFDRIAAQIAAGDLPVERVITSQVGLTEAPEAFERLASGTADEIKVLVNQ*
Ga0164299_1079965913300012958SoilERVVTRTVGLDDAPDIFAQLASGTADEIKVLVDQ*
Ga0134110_1049376123300012975Grasslands SoilVVRVVTSNVTLDAAPDAFARLASGAADEIKVLIDQ*
Ga0164309_1187505023300012984SoilDLPVERVVTRTVPLDEAPDVFAELASGSADEIKVLIDQ*
Ga0164304_1089738223300012986SoilVYDFDRIVAQIAAGDLPVERIVTRTVPLDDAPDVFAQLASGKADEIKVLIDQ*
Ga0164307_1147457723300012987SoilRIAAQIGTGRLPVERVIRSTVTLDGAPDAFARLPSGGADEIKVLVDQ*
Ga0157374_1198936623300013296Miscanthus RhizosphereFDRVAAQIAAGDLPVERDITSNVGLSDAPDAFARLASGTADEIKVLVDQ*
Ga0157378_1146803623300013297Miscanthus RhizosphereVERIVTRTARLDDAPDVFAQLASGKADEIKVLIDQ*
Ga0157378_1299005423300013297Miscanthus RhizosphereVEAQNAAGDLPVERVVTSHVELDGAPDAFERLASGAADEIKVLIDQ*
Ga0163162_1005221773300013306Switchgrass RhizosphereQIAAGDLPVERIVTRTARLNDAPDVFAQLASGKADEIKVLIDQ*
Ga0163162_1125309213300013306Switchgrass RhizosphereIAAQIGAGSLPVERVVTSSVALDDAPDAFARLASGAADEIKVLVEQ*
Ga0163162_1196289833300013306Switchgrass RhizosphereLPVERVVTSSGTLDGAPDAFARLASGAADEIKVLIGQ*
Ga0157375_1230489423300013308Miscanthus RhizosphereAAGDLPVERVVTSHVGLDDAPDAFERLASGAADEIKVLIDQ*
Ga0182008_1099465423300014497RhizosphereAAGSLPVERVITSNVGVDEAPDAFARLASGAADEIKVLVDQRGGQR*
Ga0157377_1082899713300014745Miscanthus RhizosphereGSLPVERVVTSSVALDDAPDAFARLASGAADEIKVLVEQ*
Ga0157379_1037642613300014968Switchgrass RhizosphereTWCYWVYDFDRIAAQIAAGDLPVERVVTSTHSLDEAPDAFAMLASGSADEIKVLIDQQGETR*
Ga0132258_1120253313300015371Arabidopsis RhizosphereGALPVERVVTSHVELDGAPDAFERLASGAADEIKVLIDH*
Ga0132256_10313863123300015372Arabidopsis RhizosphereAAQIAAGDLPVERVVTRTIGLDDAPDAFAELASGTADEIKVLIDQ*
Ga0132257_10280917323300015373Arabidopsis RhizosphereVERVVTSTVTLDGAPDAFERLASGAADEIKVLVDQ*
Ga0132257_10305689223300015373Arabidopsis RhizosphereLPVERVVTSSVALDDAPDAFARLASGAADEIKVLVEQ*
Ga0182039_1090911513300016422SoilAAQIAAGDLPVERVVTSNTTLDAAPDAFERLASGAADEIKVLIDQ
Ga0187821_1030413313300017936Freshwater SedimentVERVITSTVVLDDAPDAFARLASGAADEIKVLVAQ
Ga0184637_1059454613300018063Groundwater SedimentWVYDFDRIAAQIGAGDLPVERAVTSNVILDDAPDAFARLASGTADEIKVLIDHEE
Ga0184633_1033217323300018077Groundwater SedimentAAQIAAGDLPVEQAVTSNVILDDAPDAFARLASGTADEIKVLIDHEE
Ga0184639_1039805513300018082Groundwater SedimentAGDLPVERAVTSNVILDDAPDAFARLASGTADEIKVLIDHEE
Ga0066669_1192726223300018482Grasslands SoilAARVAAGRLAVERVVTGNVTLDGAPDAFARLASGAADEIKVLIDQ
Ga0173481_1059660713300019356SoilVYDFDRIAAQIAAGDLPVERVVTGRVDLDGAPEAFARLASGTADEIKVLIDQ
Ga0193747_104228313300019885SoilDFERIAAQIAAGDLPVERVVTSSVTLDDAPDAFALLASGEADEIKVLVNQ
Ga0193751_116544623300019888SoilVERVVTSSVTLDGAQDAFARLASGTADEIKVLVDQ
Ga0206353_1160808133300020082Corn, Switchgrass And Miscanthus RhizosphereVERVVTSTVSLDGAPAAFAMLSSGTADEIKVLVEQ
Ga0210378_1029338823300021073Groundwater SedimentGAGDLPVERAVTSNVILDDAPDAFARLASGTADEIKVLIDHEE
Ga0247797_100693033300023057SoilPVDRVVTSEVELDGAPDAFARLASGAADEIKVLIDQ
Ga0247754_100892933300023102SoilFERIAAQIAAGDLPVDRVVTSEVDLDGAPDAFARLASGAADEIKVLIDQ
Ga0207684_1121469813300025910Corn, Switchgrass And Miscanthus RhizosphereYDFDRIAAQIEAGDLPVERAVTSNVILDDAPDAFARLASGTADEIKVLIDHEE
Ga0207654_1106706913300025911Corn RhizospherePVERVVTSQVDLDGAPDAFARLASGAADEIKVLVDQ
Ga0207671_1153544523300025914Corn RhizosphereLPVERVVTSTVSLDGAPDAFAMLASGTADEIKVLVEQ
Ga0207663_1163421713300025916Corn, Switchgrass And Miscanthus RhizosphereAARSLPVERVITSKVALDDSPDAFERLASGAADEIKILVEQ
Ga0207649_1075995223300025920Corn RhizosphereTLPVERVVTSTVALDDAPGAFERLASGSADEIKVLVDQ
Ga0207649_1104387323300025920Corn RhizosphereAQIAAGDLPVERVITSNVDLDQAPDAFARLASGSADEIKVLVDQ
Ga0207646_1147297823300025922Corn, Switchgrass And Miscanthus RhizosphereLPVERVVTSSVTLDGAPDAFARLVSGAADEIKVLIDQ
Ga0207694_1070860913300025924Corn RhizosphereAAGDLPVERVITGSRTLDDAPDAFASLASGKADEIKVLINQ
Ga0207694_1141743513300025924Corn RhizospherePVERIVTRTVPLDDAPDVFAQLASGKADEIKVLIDQ
Ga0207659_1040485223300025926Miscanthus RhizosphereVERVVTGRVDLDGAPEAFARLASGTADEIKVLIDQ
Ga0207690_1038184123300025932Corn RhizosphereAAGDLPVERVITSNVDLDQAPDAFARLASGSADEIKVLVDQ
Ga0207690_1136001413300025932Corn RhizosphereAGDLPVERVVTRTIGLGDAPDAFAALASGTADEIKVLIDQ
Ga0207667_1142464623300025949Corn RhizosphereDRIAAHIAAGDLPVERVVTSEVDLDGAPDAFARLASGAADEIKVLVDQ
Ga0207668_1215719423300025972Switchgrass RhizosphereCYWVYDFDRIAAQIAAGDLPVERVVTRTIGLGDAPDAFAALASGTADEIKVLIDQ
Ga0207640_1139260013300025981Corn RhizosphereDRIAAQIAAGSLPVERVVTSTVTLDDAPAAFAMLASGTADEIKVLVEQ
Ga0207658_1036365713300025986Switchgrass RhizosphereCYWVYDFERIAAQIAAGDLPVERVITGSRTLDDAPDAFASLASGKADEIKVLINQ
Ga0207708_1165254113300026075Corn, Switchgrass And Miscanthus RhizosphereERIAAQIAAGDLPVERVVTGSGTLDEAPDAFARLASGKADEIKVLIDQ
Ga0207683_1170802123300026121Miscanthus RhizosphereVERVVTSHVGLDDAPDAFELLASGTADEMKILIDQ
Ga0207698_1197791323300026142Corn RhizosphereYWVYDFDRIVAQIAAGDLPVERIVTRTVPLDDAPDVFAQLASGKADEIKVSIDQ
Ga0209027_123511713300026300Grasslands SoilYGFERIAAQIATGRLPVEKIITSTVGLDDAPESFAQLASGSASEIKVLVDQ
Ga0209471_127254013300026318SoilDFGRIAAQIAAGNLPVERVVTSSHTLDDAPDAFARLASGAADEIKVLIEQ
Ga0209178_138737513300027725Agricultural SoilIGRLPVEKIITSTVGLDDAPESFAQLASGSASEIKVLVDQ
Ga0247662_105569023300028293SoilTWCYWVYDFDRVAAQIAGGGLPVERVITGTVGLDDAPDAFERLASGTADEIKVLVAQ
Ga0268265_1180119823300028380Switchgrass RhizosphereYWVYDFDRVAAQIAAGDLPVERVVTSHVELDGAPDAFERLASGAADEIKVLIDQ
Ga0247828_1103126923300028587SoilYWVYDFDRIAAQIAAGDLPVERVVTRRVDLDGAPDAFADLASGTADEIKVLVAQ
Ga0307298_1027128913300028717SoilLPVERIVTSSVTLDGAPDAFARLASGAADEIKVLINQ
Ga0307318_1011978623300028744SoilGDLPVERAVTSNVILDDAPDAFARLASGTADEIKVLIDHEE
Ga0307320_1046801623300028771SoilVERIVTSSVTLDGAPDAFARLASGAADEIKVLINQ
Ga0307287_1026244823300028796SoilGSLPVERIVTSSVTLDGAPDAFARLASGAADEIKVLINQ
Ga0307503_1065823213300028802SoilAQIGAGTLPVERVITSSVDLDGAPDAFARLASGAADEIKVLVDQ
Ga0307305_1005955933300028807SoilPVERVVTSSGALDGAPDAFARLASGAADEIKVLIDQ
Ga0307292_1014748313300028811SoilAQIAAGDLPVERVVTSSVTLDDAPDAFALLASGEADEIKVLVNQ
Ga0307286_1025857423300028876SoilRAVTSNVILDDAPDAFARLASGTADEIKVLIDHEE
Ga0307308_1013836823300028884SoilAAQIAAGDLPVERVVTSSVTLDEAPDAFALLASGEADEIKVLVNQ
Ga0247827_1072977713300028889SoilWVYDFDRIVAQIAAGDLPVERIVTRTVPLDDAPDVFAQLASGKADEIKVLIDQ
Ga0302321_10274018423300031726FenWCYWVYDFERIAAQIAAGDLPVERVVTSSVTLDEAPDAFARLASGTADEIKVLVNQ
Ga0311367_1179370723300031918FenTWCYWVYDFERIAAQIAAGDLPVERVVTSSVTLDEAPDAFARLASGTADEIKVLVNQ
Ga0307409_10020253413300031995RhizosphereFDRVASQIAAGNLPVERVITSSVGLDESPDAFARLASGSADEIKVLVDQ
Ga0307409_10202173813300031995RhizosphereAQIAAGDLPVERVVTRRVDLDGAPDAFADLASGTADEIKVLVTQ
Ga0310899_1031158413300032017SoilRIAAQIAAGDLPVERIVTRTARLDDAPDVFAQLASGKADEIKVLIDQ
Ga0308173_1227899823300032074SoilTWCYWVYDFDRIAAQIGAGSLPVERVITGTVGLDDAPDAFERLASGAADEIKVVVRQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.